DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and Arl13a

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001019537.1 Gene:Arl13a / 501617 RGDID:1562947 Length:395 Species:Rattus norvegicus


Alignment Length:210 Identity:44/210 - (20%)
Similarity:89/210 - (42%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ISCCRTSSPAMEEFQ----VLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKSAEEPI 78
            ::.|.:...|.|..|    ::::|...|||:.|.....|:...:...|         |:..:..:
  Rat     5 LTACWSRQKATEGKQRNVTIIVIGLDNSGKSHLVAAFQRLIPSKMHSE---------MRPTQTTL 60

  Fly    79 A----QLQLTEVGGNVEMQRLWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVGTQLAGKP 139
            .    |:.:.::.|:::.:..|.:|||.:|.|::..| .:|...:|....:||..:...:::|||
  Rat    61 LLDDYQVSVYDLTGDLKGREKWPNYYAEAHGLVFVVD-SSDIARIQEVKIILTRLMFDKRVSGKP 124

  Fly   140 VLLVASRHRVGVQLYD---VEYAFGLEELAKSCDCPLLICHMDETEDLHR-----------GIRW 190
            :|::|::......|..   :||.. ||.|......   :|.::....:..           |:||
  Rat   125 ILILANKQDKKDALLPCDIIEYLL-LERLVNETKS---MCRVEPCSTIRNLPKRHQQPIVIGLRW 185

  Fly   191 LCHQLMARKSQLDQR 205
            |...:..|..:|..|
  Rat   186 LLAAIGDRYDELCTR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 19/91 (21%)
P-loop_NTPase 32..194 CDD:304359 38/183 (21%)
Arl13aNP_001019537.1 Arl2l1_Arl13_like 23..189 CDD:133361 37/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.