DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and arl2

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001005947.1 Gene:arl2 / 449774 ZFINID:ZDB-GENE-041010-19 Length:184 Species:Danio rerio


Alignment Length:176 Identity:44/176 - (25%)
Similarity:83/176 - (47%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFQVLILGPSGSGKTEL-----GHRLSRVSRDRDDQEATNGVRCYRMKSAEEPIAQLQLTEVGGN 89
            |.::|:||...:|||.:     |..:|.:|       .|.|   :.:|:.|....:|.:.:|||.
Zfish    16 EMRLLMLGLDNAGKTTILKKFNGEDVSTIS-------PTLG---FNIKTLEHRGFKLNIWDVGGQ 70

  Fly    90 VEMQRLWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVGTQLAGKPVLLVASRHRV-GVQL 153
            ..::..|::|:.|:..|::..| .||.:.:......|...|:..:|||..:|:.|::..: |...
Zfish    71 KPLRSYWRNYFESTDGLVWVVD-SADRLRLDDCRKELNALLLEERLAGATLLVFANKQDLPGALS 134

  Fly   154 YD-VEYAFGLEELAKSCDCPLLICHMDETEDLHRGIRWLCHQLMAR 198
            .| :.....|:::.....| ::.|.....|:|..|:.||...:.||
Zfish   135 KDGIREVLALDDIKTHHWC-IVGCSAVTGENLLSGVDWLLDDIAAR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 22/85 (26%)
P-loop_NTPase 32..194 CDD:304359 41/168 (24%)
arl2NP_001005947.1 Arl2 3..175 CDD:206720 42/170 (25%)
small_GTP 16..170 CDD:272973 40/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45697
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.