DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and ARL3

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_004302.1 Gene:ARL3 / 403 HGNCID:694 Length:182 Species:Homo sapiens


Alignment Length:179 Identity:46/179 - (25%)
Similarity:84/179 - (46%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EEFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKSAEEPIAQLQLTEVGGNVEMQ 93
            :|.::|:||...:|||.|..:|:  |.|......|.|   :.:||.:....:|.:.::||..:::
Human    16 QEVRILLLGLDNAGKTTLLKQLA--SEDISHITPTQG---FNIKSVQSQGFKLNVWDIGGQRKIR 75

  Fly    94 RLWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVGTQLAGKPVLLVASRHRVGVQLYDVEY 158
            ..||:|:.::..|||..| .||....:.|...|.:.|...:|:..|||:.|::.       |:..
Human    76 PYWKNYFENTDILIYVID-SADRKRFEETGQELAELLEEEKLSCVPVLIFANKQ-------DLLT 132

  Fly   159 AFGLEELAKSCDC--------PLLICHMDETEDLHRGIRWLCHQLMARK 199
            |....|:|:..:.        .:..|.....|.:..|:.|:|..:.|:|
Human   133 AAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 24/81 (30%)
P-loop_NTPase 32..194 CDD:304359 43/169 (25%)
ARL3NP_004302.1 Arl3 3..176 CDD:206721 44/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.