DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and Arl1

DIOPT Version :10

Sequence 1:NP_572786.3 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster


Alignment Length:172 Identity:44/172 - (25%)
Similarity:85/172 - (49%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKSAEEPIAQLQLTEVGGNVEMQR 94
            |.::||||..|:|||.:.:||     ...:...|.....:.::.......:.|:.::||...::.
  Fly    16 EMRILILGLDGAGKTTILYRL-----QVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRP 75

  Fly    95 LWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVGTQLAGKPVLLVASRHRVG--VQLYDVE 157
            .|:.||:::.|:||..| .||...:..:...|...|...:|||..::::|::..:.  :.:.:|.
  Fly    76 YWRCYYSNTDAIIYVVD-SADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVH 139

  Fly   158 YAFGLEELAKSCDCPLLICHMDETEDLHRGIRWLCHQLMARK 199
            :|.|||.| |:....:......:.|.|.:.:.||.:.|.:||
  Fly   140 HALGLENL-KNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.3 P-loop containing Nucleoside Triphosphate Hydrolases 32..194 CDD:476819 40/163 (25%)
Arl1NP_524098.2 Arl1 18..175 CDD:206718 40/163 (25%)

Return to query results.
Submit another query.