DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and arl3l2

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_957013.1 Gene:arl3l2 / 393692 ZFINID:ZDB-GENE-040426-1678 Length:187 Species:Danio rerio


Alignment Length:171 Identity:46/171 - (26%)
Similarity:80/171 - (46%) Gaps:7/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKSAEEPIAQLQLTEVGGNVEMQR 94
            |.::|:||...:|||.|...|:  |.|.:....|.|   :.:|:......:|.:.::||..:::.
Zfish    22 ELRILLLGLDNAGKTTLLKSLA--SEDVNTITPTQG---FNIKTVASRGMKLNVWDIGGQRKIRP 81

  Fly    95 LWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVGTQLAGKPVLLVASRHRVGVQLYDVEYA 159
            .||.|..::..|:|..| .||....:.|...|::.:....|.|.|||:.|::..:|......|.|
Zfish    82 FWKKYLENTDLLVYVID-SADKKRFEETGLELSELIDEENLCGVPVLIFANKQDLGTAAPASEIA 145

  Fly   160 FGLE-ELAKSCDCPLLICHMDETEDLHRGIRWLCHQLMARK 199
            .||. ...:.....:..|.....|.:..|:.|:|:.|:.||
Zfish   146 EGLNLHTYRDRVWQIQACSAITGEGVQDGMNWICNNLVNRK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 22/80 (28%)
P-loop_NTPase 32..194 CDD:304359 42/162 (26%)
arl3l2NP_957013.1 Arl3 8..181 CDD:206721 43/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.