Sequence 1: | NP_572786.2 | Gene: | CG11356 / 32178 | FlyBaseID: | FBgn0030375 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001155963.1 | Gene: | ARL13A / 392509 | HGNCID: | 31709 | Length: | 256 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 53/200 - (26%) |
---|---|---|---|
Similarity: | 90/200 - (45%) | Gaps: | 31/200 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KLCDCCCYHQTISCCRTSSPAMEEFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRM 71
Fly 72 KSAEEPIA----QLQLTEVGGNVEMQRLWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVG 132
Fly 133 TQLAGKPVLLVASRHRVGVQLYD---VEYAFGLEELAKSCDCPLLICHMDETEDLHR-------- 186
Fly 187 GIRWL 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11356 | NP_572786.2 | Gem1 | 27..>111 | CDD:224025 | 20/87 (23%) |
P-loop_NTPase | 32..194 | CDD:304359 | 45/174 (26%) | ||
ARL13A | NP_001155963.1 | Arl2l1_Arl13_like | 23..189 | CDD:133361 | 45/174 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0073 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |