DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and ARL13A

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001155963.1 Gene:ARL13A / 392509 HGNCID:31709 Length:256 Species:Homo sapiens


Alignment Length:200 Identity:53/200 - (26%)
Similarity:90/200 - (45%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLCDCCCYHQTISCCRTSSPAMEEFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRM 71
            :|...||     ||.||:........:.|:|.:.||||.|.....::...:.|       .|  |
Human     3 RLLSSCC-----SCLRTTEETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTD-------HC--M 53

  Fly    72 KSAEEPIA----QLQLTEVGGNVEMQRLWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVG 132
            ||....:.    :|.:.::.|:::.:..|.:|||.:|.|::..| .:|...||....:||..|..
Human    54 KSELTTLLLDEYELSIYDLNGDLKGREAWPNYYAQAHGLVFVLD-SSDIRRMQEVKIILTHLLSD 117

  Fly   133 TQLAGKPVLLVASRHRVGVQLYD---VEYAFGLEELAKSCDCPLLICHMDETEDLHR-------- 186
            .::||||:|::|::......|..   ::|.. |::|.|...||..:.......:|.|        
Human   118 KRVAGKPILILANKQDKKKALMPCDIIDYLL-LKKLVKENKCPCRVEPCSAIRNLERRNHQPIVE 181

  Fly   187 GIRWL 191
            |:|||
Human   182 GLRWL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 20/87 (23%)
P-loop_NTPase 32..194 CDD:304359 45/174 (26%)
ARL13ANP_001155963.1 Arl2l1_Arl13_like 23..189 CDD:133361 45/174 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.