DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and arl-3

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_497037.1 Gene:arl-3 / 175121 WormBaseID:WBGene00000188 Length:184 Species:Caenorhabditis elegans


Alignment Length:184 Identity:47/184 - (25%)
Similarity:81/184 - (44%) Gaps:30/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPAMEEFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKS-AEEPIAQLQLTEVGG 88
            ||:..|.::|:||...:|||.:..:||  |.|......|.|   :.:|: |.....:|.:.::||
 Worm    12 SPSGREIRILLLGLDNAGKTTILKQLS--SEDVQHVTPTKG---FNVKTVAAMGDIRLNVWDIGG 71

  Fly    89 NVEMQRLWKHYYASSHALIYCFDLG----ADPMVMQGTFSLLTDCLVGTQLAGKPVLLVASRHRV 149
            ...::..|.:||.:...||:..|..    .|.|.::     |.:.|...:|...|||:.|::.  
 Worm    72 QRSIRPYWSNYYENIDTLIFVIDSNDKKRFDEMNIE-----LGELLDEEKLRKVPVLIFANKQ-- 129

  Fly   150 GVQLYDVEYAFGLEELAKSCDCPLL--------ICHMDETEDLHRGIRWLCHQL 195
                 |:..|...||:.:..:..||        .|...:.|.::.||.|:...|
 Worm   130 -----DLVTAASSEEITRKLNLDLLRDRTWHIQACSALKNEGINDGITWVASNL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 23/84 (27%)
P-loop_NTPase 32..194 CDD:304359 43/174 (25%)
arl-3NP_497037.1 Arl3 3..177 CDD:206721 46/181 (25%)
Ras 19..175 CDD:278499 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.