DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11356 and arl-13

DIOPT Version :9

Sequence 1:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001032986.1 Gene:arl-13 / 171765 WormBaseID:WBGene00021349 Length:370 Species:Caenorhabditis elegans


Alignment Length:152 Identity:40/152 - (26%)
Similarity:66/152 - (43%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CCCYHQTISCCRTSSPAM-EEFQVLILGPSGSGKTELGHRLSRVSRDRDDQE--ATNGVRCYRMK 72
            |||.|:|        |.: .|.::...|...:|||    ...:|.:..|.::  .|||....:|:
 Worm    12 CCCCHRT--------PIIRREIKLGCFGIGSAGKT----TFLKVLKGEDPRDLLRTNGFSTVKME 64

  Fly    73 SAEEPIAQLQLTEVGGNVEMQRLWKHYYASSHALIYCFDLGADPMVMQGTFSL--LTDCLVGTQL 135
            ..|  ...|.:.:|||:..::.:|.:|||..|.:||..|...|....:...:|  ||.   ...:
 Worm    65 YDE--TFHLTIYDVGGDKGIRGIWSNYYAEVHGIIYVIDYSTDETFTESIEALHSLTS---NPHV 124

  Fly   136 AGKPVLLVASRHRVGVQLYDVE 157
            ..||:.|:.:... ..:..|||
 Worm   125 QKKPIFLLLNNQN-NREFDDVE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 23/86 (27%)
P-loop_NTPase 32..194 CDD:304359 33/130 (25%)
arl-13NP_001032986.1 Gem1 23..>166 CDD:224025 34/133 (26%)
P-loop_NTPase 27..>137 CDD:304359 30/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.