DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5R and Uchl5

DIOPT Version :9

Sequence 1:NP_572781.1 Gene:Uch-L5R / 32173 FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_062508.2 Gene:Uchl5 / 56207 MGIID:1914848 Length:329 Species:Mus musculus


Alignment Length:330 Identity:161/330 - (48%)
Similarity:228/330 - (69%) Gaps:21/330 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAGRVV 85
            |..|||:|||||||||:|.||||.||:||||||::.::|..|:|:|||||||||. .::|||.||
Mouse     5 AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGSVV 69

  Fly    86 TDR--SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEE 148
            .|.  ..||||:|||.|||||||::.:|||..|:|:.||:||::.:...|..|...:|..|:|.:
Mouse    70 QDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD 134

  Fly   149 KIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLD 213
            .||:|||||||.::|..:..|...|:|.:|||.::|:.|:|:||||:.||||:|...: |.:|:.
Mouse   135 VIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACN-QDDWIT 198

  Fly   214 VVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADR------------- 265
            .|||:||.|:::||.|||.|||||:||||:..||:||   ..|..||:..:.             
Mouse   199 AVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI---AELQRQLAEEEPMDTDQGSTVLSAI 260

  Fly   266 QAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDRSYLCKP 330
            |:|:|..:..:..|.:|.:||:.|||||:|||||||:||||.|.|..||:.:.:|||::.. .|.
Mouse   261 QSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN-AKK 324

  Fly   331 SKDTR 335
            :::|:
Mouse   325 AQETK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 116/215 (54%)
Uchl5NP_062508.2 Peptidase_C12 8..223 CDD:187736 116/215 (54%)
UCH_C 264..309 CDD:375501 23/44 (52%)
Interaction with ADRM1. /evidence=ECO:0000250 313..329 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849801
Domainoid 1 1.000 64 1.000 Domainoid score I10105
eggNOG 1 0.900 - - E1_KOG2778
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1802
OMA 1 1.010 - - QHG53985
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001783
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1589
SonicParanoid 1 1.000 - - X1137
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.