DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5R and Uchl5

DIOPT Version :9

Sequence 1:NP_572781.1 Gene:Uch-L5R / 32173 FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001380778.1 Gene:Uchl5 / 360853 RGDID:1305414 Length:329 Species:Rattus norvegicus


Alignment Length:330 Identity:161/330 - (48%)
Similarity:227/330 - (68%) Gaps:21/330 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAGRVV 85
            |..|||:|||||||||:|.||||.||:||||||::.:.|..|:|:|||||||||. .::|||.||
  Rat     5 AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVV 69

  Fly    86 TDR--SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEE 148
            .|.  ..||||:|||.|||||||::.:|||..|:|:.||:||::.:...|..|...:|..|:|.:
  Rat    70 QDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD 134

  Fly   149 KIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLD 213
            .||:|||||||.::|..:..|...|:|.:|||.::|:.|:|:||||:.||||:|...: |.:|:.
  Rat   135 VIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACN-QDDWIT 198

  Fly   214 VVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADR------------- 265
            .|||:||.|:::||.|||.|||||:||||:..||:||   ..|..||:..:.             
  Rat   199 AVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI---AELQRQLAEEEPMDTDQGSTVLSAI 260

  Fly   266 QAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDRSYLCKP 330
            |:|:|..:..:..|.:|.:||:.|||||:|||||||:||||.|.|..||:.:.:|||::.. .|.
  Rat   261 QSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN-AKK 324

  Fly   331 SKDTR 335
            :::|:
  Rat   325 AQETK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 116/215 (54%)
Uchl5NP_001380778.1 Peptidase_C12 8..223 CDD:187736 116/215 (54%)
UCH_C 264..309 CDD:407868 23/44 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353476
Domainoid 1 1.000 64 1.000 Domainoid score I9913
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 345 1.000 Inparanoid score I2248
OMA 1 1.010 - - QHG53985
OrthoDB 1 1.010 - - D1363547at2759
OrthoFinder 1 1.000 - - FOG0001783
OrthoInspector 1 1.000 - - otm44455
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1137
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.