DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5R and Uch

DIOPT Version :9

Sequence 1:NP_572781.1 Gene:Uch-L5R / 32173 FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster


Alignment Length:233 Identity:66/233 - (28%)
Similarity:102/233 - (43%) Gaps:23/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WCLIESDPGVFTEMISGFGCTGA-EVEEIWSIKADAFRHL-EPIHGLIFLFKWLDDKPAGRVVT- 86
            |..:||:|.|.|:.|...|.:.| .|.::..::.|....: .|:...|.||...:.....|... 
  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68

  Fly    87 DR---------SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGH 142
            ||         .|:|:.||...|||.|.||:..:.|.:..|||.| .|.|.......|.||.||.
  Fly    69 DRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKEVDIDRG-VLKDFLEKTASLSPEERGR 132

  Fly   143 RLANEEKIRKVHNSFARPELFVVEESTDFI--EDDCYHFVGFMPIKGKLFELDGMHEGPIELADI 205
            .|..:||....|.:.|:      |..|:..  |...:||:..:..:|.|:||||....||:....
  Fly   133 ALEKDEKFTADHEALAQ------EGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPT 191

  Fly   206 DQQQNWLDVVRPIIEARMERYSVGEIHFNLMALVSDRQ 243
            .::....|..: :.:..|.| ...|:.|.::||.:.:|
  Fly   192 SEETFVKDAAK-VCKEFMAR-DPNEVRFTVLALTAAQQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 63/226 (28%)
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 63/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10589
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.