DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5R and Bap1

DIOPT Version :9

Sequence 1:NP_572781.1 Gene:Uch-L5R / 32173 FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001100762.1 Gene:Bap1 / 306257 RGDID:1311938 Length:740 Species:Rattus norvegicus


Alignment Length:286 Identity:97/286 - (33%)
Similarity:155/286 - (54%) Gaps:46/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WCLIESDPGVFTEMISGF-------------GCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL 76
            |..:|||||:||.::..|             |..|.:||||:.:::   :...|::|.||||||:
  Rat     5 WLELESDPGLFTLLVEDFGKNPFTPDRRALAGVKGVQVEEIYDLQS---KCQGPVYGFIFLFKWI 66

  Fly    77 DDKPAGRVVTDRSD------------IFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLR 129
            :::.:.|.|:...|            :|||.|:|||:|||.|||.:|||.  .::|||.||:.::
  Rat    67 EERRSRRKVSTLVDDTSVIDDDIVNSMFFAHQLIPNSCATHALLSVLLNC--SNVDLGPTLSRMK 129

  Fly   130 NLCQDLDPECRGHRLANEEKIRKVHNSFARPELFVVEESTDFIED----DCYHFVGFMPIKGKLF 190
            :..:...||.:|:.:.|..::.|.|||.||||...:.|..:.:..    :.:|||.::||.|:||
  Rat   130 DFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLF 194

  Fly   191 ELDGMHEGPIELADIDQQQNWLDVVRPIIEARMERYSVGE----IHFNLMALVSDRQRCYERKIQ 251
            ||||:...||:.....:.:.|.|..|.:|..|:...:.||    |.|||||:|.||:..||.::.
  Rat   195 ELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRVKYEARLH 259

  Fly   252 MLVNLPSQLSHADRQAEIANLRSHVR 277
            :|        ..:||..:..|:..:|
  Rat   260 VL--------KGNRQTVLEALQQLIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 86/245 (35%)
Bap1NP_001100762.1 Peptidase_C12_UCH37_BAP1 5..246 CDD:187738 86/245 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..364
HBM-like motif. /evidence=ECO:0000250|UniProtKB:Q92560 376..379
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..448
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..535
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 586..635
Interaction with BRCA1. /evidence=ECO:0000250 607..732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..740
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q92560 728..733
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.