DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5R and uchl5

DIOPT Version :9

Sequence 1:NP_572781.1 Gene:Uch-L5R / 32173 FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002939132.1 Gene:uchl5 / 100124308 XenbaseID:XB-GENE-968743 Length:329 Species:Xenopus tropicalis


Alignment Length:322 Identity:157/322 - (48%)
Similarity:221/322 - (68%) Gaps:20/322 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ATAANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAG 82
            |.:|..|||:|||||||||:|.||||.|.:||||||::.:.|..|:|:.||||||||. .::|||
 Frog     2 AGSAGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEEPAG 66

  Fly    83 RVVTD-RSD-IFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLA 145
            .||.| |.| ||||:|||.|||||||::.:|||..|.|:.||:||::.:...|..|...:|..|:
 Frog    67 SVVQDSRLDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQSFDAAMKGLALS 131

  Fly   146 NEEKIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQN 210
            |.|.||:|||||||.::|..:..:...:||.:|||.::|:.|:|:||||:.:|||:|... ::..
 Frog   132 NSEVIRQVHNSFARQQMFEFDAKSTTKDDDAFHFVSYVPVNGRLYELDGLRDGPIDLGPC-KEDE 195

  Fly   211 WLDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSH------------- 262
            |:...||:||.||::|..|||.|||||:||||::.||:||   .:|..:|:.             
 Frog   196 WISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKI---TDLQRRLAEEEPMDTDQGSTLM 257

  Fly   263 ADRQAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDR 324
            :..|:|||..:..:..|.:|.:||:.|||||:|||||||:||||.|.|..||:.:.:|||::
 Frog   258 SSMQSEIAKYQLLIEEENQKIKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 113/215 (53%)
uchl5XP_002939132.1 Peptidase_C12_UCH37_BAP1 8..223 CDD:187738 113/215 (53%)
UCH_C 264..309 CDD:375501 24/44 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10160
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1934
OMA 1 1.010 - - QHG53985
OrthoDB 1 1.010 - - D1363547at2759
OrthoFinder 1 1.000 - - FOG0001783
OrthoInspector 1 1.000 - - otm47500
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1589
SonicParanoid 1 1.000 - - X1137
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.