DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP735A2

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:535 Identity:117/535 - (21%)
Similarity:199/535 - (37%) Gaps:157/535 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPE---CLDKTFL----- 105
            |.::|.| |:.::..:.|.:.:.    .|.|.:::           |..|   ||.:|.:     
plant    72 CSSIHHN-IVPRLLPHYVSWSKQ----YGKRFIMW-----------NGTEPRLCLTETEMIKELL 120

  Fly   106 -------------QDGF--FVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVE 155
                         |.|.  |:.||||.|.|:.|..:|....|||:.:.:..:..........|.|
plant   121 TKHNPVTGKSWLQQQGTKGFIGRGLLMANGEAWHHQRHMAAPAFTRDRLKGYAKHMVECTKMMAE 185

  Fly   156 QFQTQTNLHGQAV-------KFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLE 213
            :.:.:.   |:.|       :.||  |::||.....||                   ...|.|..
plant   186 RLRKEV---GEEVEIGEEMRRLTA--DIISRTEFGSSC-------------------DKGKELFS 226

  Fly   214 ISAVRVVKPWLQIRLLHRLLA--------------PELYEESKKCAKL-LEDFVGGIVRTKHRNW 263
            :           :.:|.||.|              |..|....|..|. :|..:..|:.::    
plant   227 L-----------LTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSLKTEVERLLMEIIDSR---- 276

  Fly   264 RLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAAN------GEMTLEEIMDEAQSMVLVSFETVSN 322
              :|:|   :.|..:|.|       :.:..|..|      ..:.::.||||.::......||.|.
plant   277 --KDSV---EIGRSSSYG-------DDLLGLLLNQMDSNKNNLNVQMIMDECKTFFFTGHETTSL 329

  Fly   323 SIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRH 387
            .:...|:.||.|. ..|..:..|:|.:....|...:|||..|..|:..::|||||.....:..|.
plant   330 LLTWTLMLLAHNP-TWQDNVRDEVRQVCGQDGVPSVEQLSSLTSLNKVINESLRLYPPATLLPRM 393

  Fly   388 VSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGS 452
            ...|.:|.    :.|:|:...:.:....:......||.:|.:|:|:||                 
plant   394 AFEDIKLG----DLIIPKGLSIWIPVLAIHHSNELWGEDANEFNPERF----------------- 437

  Fly   453 GEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISL 517
             ..|.....||   |:||:.|.|:|||:.:.:...|:.|..|::.|.|.             ||.
plant   438 -TTRSFASSRH---FMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFA-------------ISE 485

  Fly   518 KFKNADDILLTIQPK 532
            .:::|..::|||:||
plant   486 NYRHAPIVVLTIKPK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 109/504 (22%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 117/535 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.