DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP702A1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:524 Identity:102/524 - (19%)
Similarity:184/524 - (35%) Gaps:160/524 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRRGLLHA 118
            |..|.|::.:|...|:   ..|.|.:|::..|....||        :.||            .||
plant    61 PTFIKERIIRYGPIFR---TSLFGAKVIISTDIELNME--------IAKT------------NHA 102

  Fly   119 RGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAE--DLLSRAV 181
            .|     ..|.:...|..|.:  ||....|..:.....||.   |..|.:|.:..:  |||:|..
plant   103 PG-----LTKSIAQLFGENNL--FFQSKESHKHVRNLTFQL---LGSQGLKLSVMQDIDLLTRTH 157

  Fly   182 LEV----SCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRV---VKP----------------W 223
            :|.    .||.:...              |.|.|:|..|.:|   ::|                |
plant   158 MEEGARRGCLDVKEI--------------SSKILIECLAKKVTGDMEPEAAKELALCWRCFPSGW 208

  Fly   224 LQIRLLHRLLAPELY---EESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRR 285
            .:..|  .|....:|   :..|:...||::.:            |:....||:.||         
plant   209 FRFPL--NLPGTGVYKMMKARKRMLHLLKETI------------LKKRASGEELGE--------- 250

  Fly   286 IFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAE----I 346
             |.:.||:.|..  |:::..::...::.|::.||... |:.|.:.|.::.....:.|..|    :
plant   251 -FFKIIFEGAET--MSVDNAIEYIYTLFLLANETTPR-ILAATIKLISDNPKVMKELHREHEGIV 311

  Fly   347 RALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVL 411
            |........:..|:.:.:.:....::||||:.:|.|...|....:|::...:    :|...|   
plant   312 RGKTEKETSITWEEYKSMTFTQMVINESLRITSTAPTVFRIFDHEFQVGSYK----IPAGWI--- 369

  Fly   412 DTFNMQRDERWWGANARQFDPQRFLD-------QEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLP 469
                      :.|.....|:|:.:.|       :.|.:      |.|:...|         :::|
plant   370 ----------FMGYPNNHFNPKTYDDPLVFNPWRWEGK------DLGAIVSR---------TYIP 409

  Fly   470 FSNGLRSCIGRRYGLFIMKVFL-------------VKLITNF--DFQSDFELEKLQFVENISLKF 519
            |..|.|.|:|..:....|.:|:             ..::.||  .|.:..|::.|:..|..:...
plant   410 FGAGSRQCVGAEFAKLQMAIFIHHLSRDRWSMKIGTTILRNFVLMFPNGCEVQFLKDTEVDNSSG 474

  Fly   520 KNAD 523
            .|.|
plant   475 SNPD 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 97/502 (19%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 94/484 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.