DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP96A8

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:515 Identity:101/515 - (19%)
Similarity:196/515 - (38%) Gaps:127/515 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PVLWLLLCINLHPNSI----LEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDK 102
            |||.:|..:.|....|    :|.:....:.||......||..||..: |||.:..::::.   ..
plant    45 PVLGMLPGVLLRLQRIYDCSVEVLENSNMTFQFKGPWFVGMDVLATV-DPANIHHIMSSN---FS 105

  Fly   103 TFLQDGFF------VRRGLLHARGQKWKLRRKQLNPAFSH----NIVAS---------FFDVFNS 148
            .:::...|      ...|:::...:.|:..|......|:|    |..||         ...:||.
plant   106 NYIKGPIFHEIFEAFGDGIINTDAELWRDWRNASQLIFNHQRYQNFSASTTKTKVNDGLVPLFNH 170

  Fly   149 VGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLE 213
            ..|:.:               ....||:..|.:.:::.:.|.||......::...:..| |.|.:
plant   171 FANEEI---------------VVDLEDVFQRFMYDITFIFITGTDPRSLSIEMPEVEFS-KALDD 219

  Fly   214 ISAVRVVKPWLQIRLLHRLLAPELYEESKK--------------------CAKLLEDFVGGIVRT 258
            :...          ::||.:.|....:.:|                    |.|        |:..
plant   220 VGDA----------IVHRHITPRFVWKLQKWIGIGTEKKMLKAHATFDRVCEK--------IIAA 266

  Fly   259 KHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSF------ 317
            |      |:.:|.:  |...::..:|...:....:|.|    |..|::..:....|..|      
plant   267 K------REELGSQ--GITYNSNGEREDLLTSFIKLDA----TKYEVLKPSHDKFLRDFTIGFMA 319

  Fly   318 ---ETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVG--QVGLEQLQQLRYLDAFVSESLRL 377
               ::.::::......|:.|. :...::|.||...:|..|  |.....|.:|.||...:|||:||
plant   320 AGRDSTASTLTWFFWNLSKNP-NVLTKILQEINTNLPRTGSDQDMSSYLNKLVYLHGALSESMRL 383

  Fly   378 LATVPMNLRH-VSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEE 441
            ...:|...:. :..|...:|.:    |..|..:::..:.|.|.:..||.:|.:|.|:|::     
plant   384 YPPIPFQRKSPIKEDVLPSGHK----VKSNINIMIFIYAMGRMKTIWGEDAMEFKPERWI----- 439

  Fly   442 QLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQ 501
                    |.:|..|.:    .||.||.|:.|.|:|:|:...:.:||..:|:::.|::.:
plant   440 --------SETGGVRHE----PSYKFLSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 101/515 (20%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 101/515 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.