DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP97A3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:439 Identity:103/439 - (23%)
Similarity:193/439 - (43%) Gaps:60/439 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GTRVLLYIDDPAGMECVL--NAPECLDKTFLQD--GFFVRRGLLHARGQKWKLRRKQLNPAFSHN 137
            |.:..|.:.||:..:.:|  || :...|..|.:  .|.:.:||:.|.|:.|:.||:.:.||....
plant   148 GPKSFLIVSDPSIAKHILKDNA-KAYSKGILAEILDFVMGKGLIPADGEIWRRRRRAIVPALHQK 211

  Fly   138 IVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQL-DD 201
            .||:...:|....:::.::..... |.|:.|:.   |.|.||..|::....:..  .:|..| :|
plant   212 YVAAMISLFGEASDRLCQKLDAAA-LKGEEVEM---ESLFSRLTLDIIGKAVFN--YDFDSLTND 270

  Fly   202 AHIAHSYKRLLEISAVRVVKP--------WLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRT 258
            ..:..:...:|..:..|.|.|        |..|....|.:|..|        ||:.|.:..::.|
plant   271 TGVIEAVYTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSL--------KLINDTLDDLIAT 327

  Fly   259 KHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNS 323
            ..|.....:.    :..|:..|.....|.   .|.||:..:::.:::.|:..:|::...|| |.:
plant   328 CKRMVEEEEL----QFHEEYMNERDPSIL---HFLLASGDDVSSKQLRDDLMTMLIAGHET-SAA 384

  Fly   324 IMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHV 388
            ::.....|.|.:.....:|..|:.:::.|.... ::.:::|:|....::|||||....|:.:|. 
plant   385 VLTWTFYLLTTEPSVVAKLQEEVDSVIGDRFPT-IQDMKKLKYTTRVMNESLRLYPQPPVLIRR- 447

  Fly   389 SRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRF-LDQEEEQLSKGHNDSGS 452
            |.|..:.|   |..:.:...:.:..:|:.|....|. :|.:|:|:|: ||        |.|.:  
plant   448 SIDNDILG---EYPIKRGEDIFISVWNLHRSPLHWD-DAEKFNPERWPLD--------GPNPN-- 498

  Fly   453 GEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQ 501
                   :...::|:|||..|.|.|||..:..|...|.:..||..|:||
plant   499 -------ETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQ 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 103/439 (23%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 103/439 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.