DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP94B1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001331365.1 Gene:CYP94B1 / 836464 AraportID:AT5G63450 Length:568 Species:Arabidopsis thaliana


Alignment Length:465 Identity:106/465 - (22%)
Similarity:194/465 - (41%) Gaps:64/465 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WLLLCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVL-----NAPECLDKTF 104
            |....:.|.|:..:            .:.:|.|.|.:: ..:|..:|.:|     |.|:....|.
plant   118 WYTDLLRLSPSQTI------------TVDLLFGRRTII-TANPENVEHILKTNFYNFPKGKPFTD 169

  Fly   105 LQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASF-FDVF-NSVGNQMVEQFQTQTNLHGQA 167
            |. |..:..|:.::.|:.|..:||..:..|:...:..| |::. ..|.|:::....:..:. |:.
plant   170 LL-GDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEVQNRLIPVLSSAVDC-GET 232

  Fly   168 VKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDD--AHIAHSYKRLLEISAVRVVKPWLQIRLLH 230
            |.|   :::|.|...:|.|...:|...:...|..  ..:..::....||||.|..:|...:..:.
plant   233 VDF---QEVLKRFAFDVVCKVSLGWDPDCLDLTRPVPELVKAFDVAAEISARRATEPVYAVWKVK 294

  Fly   231 RLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLA 295
            |.|.....:..::..|.:...|..|:|.|.::.    .:||:.|  |..:...|       |..|
plant   295 RFLNVGSEKRLREAIKTVHLSVSEIIRAKKKSL----DIGGDVS--DKQDLLSR-------FLAA 346

  Fly   296 ANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGL-- 358
            .:||   |.:.|...|.::...:|.| :.|..|..|.:...|.:.::|.|:|    :.|.:||  
plant   347 GHGE---EAVRDSVISFIMAGRDTTS-AAMTWLFWLLSQNDDVETKILDELR----NKGSLGLGF 403

  Fly   359 EQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWW 423
            |.|:::.|..|.:.|::||...|..:.:|.:.|..|   ...|.:.:...|....:.|.|.|:.|
plant   404 EDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDIL---PDGTPLKKGDKVTYFPYGMGRMEKVW 465

  Fly   424 GANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMK 488
            |.:..:|.|.|:.::|....:|....|.|           |:.|..|..|.|.|||:......||
plant   466 GKDWDEFKPNRWFEEEPSYGTKPVLKSVS-----------SFKFPVFQAGPRVCIGKEMAFTQMK 519

  Fly   489 VFLVKLITNF 498
            ..:..:::.|
plant   520 YVVGSVLSRF 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 106/465 (23%)
CYP94B1NP_001331365.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.