DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP735A1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 / 833833 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana


Alignment Length:453 Identity:105/453 - (23%)
Similarity:175/453 - (38%) Gaps:115/453 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAV------ 168
            |:.||||.|.||.|..:|....|||:...:..:........:::||:.:.:.......|      
plant   139 FIGRGLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVECTSKLVERLRKEVGEGANEVEIGEEM 203

  Fly   169 -KFTAAEDLLSR-----------------AVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEIS 215
             |.||  |::||                 .||:..|...           ..|:.....|.|...
plant   204 HKLTA--DIISRTKFGSSFEKGKELFNHLTVLQRRCAQA-----------TRHLCFPGSRFLPSK 255

  Fly   216 AVRVVKPWLQIRLLHRLLAPELYEESKKCAKL------LEDFVGGIVRTKHRNWRLRDAVGGEKS 274
            ..|.:|...  :.:.|||. |:.:..:.||::      .:|.:|.::               .:.
plant   256 YNREIKSLK--KEVERLLI-EIIQSRRDCAEMGRSSTHGDDLLGLLL---------------NEM 302

  Fly   275 GEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQ 339
            ..|.:|.               |....|:.||||.::......||.:..:....:.||.|. ..|
plant   303 DIDKNNN---------------NNNNNLQLIMDECKTFFFAGHETTALLLTWTTMLLADNP-TWQ 351

  Fly   340 RRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVP 404
            .::..|:|.:....|...::||.:|..|...::|||||.....:..|....|.:|.    :..:|
plant   352 EKVREEVREVFGRNGLPSVDQLSKLTSLSKVINESLRLYPPATLLPRMAFEDLKLG----DLTIP 412

  Fly   405 QNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLP 469
            :...:.:....:...|..||.:|.||:|:||          |.....||        ||   |:|
plant   413 KGLSIWIPVLAIHHSEELWGKDANQFNPERF----------GGRPFASG--------RH---FIP 456

  Fly   470 FSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPK 532
            |:.|.|:|||:::.|...|:.|..||:.|:|             .||..:::|..::|||:||
plant   457 FAAGPRNCIGQQFALMEAKIILATLISKFNF-------------TISKNYRHAPIVVLTIKPK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 97/422 (23%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 105/453 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.