DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and AT5G08250

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001330676.1 Gene:AT5G08250 / 830721 AraportID:AT5G08250 Length:550 Species:Arabidopsis thaliana


Alignment Length:467 Identity:98/467 - (20%)
Similarity:182/467 - (38%) Gaps:118/467 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DPAGMECVLNAPECLDKT---FLQDGFFVRR--------GLLHARGQKWKLRRKQLNPAFSHNIV 139
            ||..:|.:|       ||   ....|.:.|.        |:.:.....|:.:||..:..| |:  
plant   115 DPRNVEHLL-------KTRFSIYPKGSYFRETMQDLLGDGIFNTDDGTWQRQRKAASVEF-HS-- 169

  Fly   140 ASFFDVFNS-----VGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTN--FT 197
            |.|..:.:.     |.|:::...:|...:.        .:|:|.|...:..|:...|....  ..
plant   170 AKFRQLTSQSLHELVHNRLLPVLETSGKID--------LQDILLRLTFDNVCMIAFGVDPGCLSP 226

  Fly   198 QLDDAHIAHSYKRLLEISAVRVVKP---WLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTK 259
            :|.:...|.:::...|.:.||.|.|   |..:|.|:  |..|  ::.|:....::||...::||:
plant   227 KLPEIPFAKAFEDATEATVVRFVMPKFVWKLMRSLN--LGTE--KKLKESINGVDDFAEEVIRTR 287

  Fly   260 HRNWRLRDAVG------------GEKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSM 312
            .:...|...:.            .:::|:..|:.:.|.|.:.  |.||..          :..|:
plant   288 KKEMSLETEIAKRPDLLTIFMGLRDENGQKFSDKFLRDICVN--FILAGR----------DTSSV 340

  Fly   313 VLVSF-------ETVSNSIMLALLCLATNK---GDCQRRLLAEIRALVPDVGQVGLEQLQQLRYL 367
            .|..|       ..|...||:.:..:...:   ||.::.:..| ....|       |:::::.||
plant   341 ALSWFFWLIEKNPEVEEKIMMGICKILEQRVDHGDTKKNMEYE-PVFRP-------EEIKKMDYL 397

  Fly   368 DAFVSESLRLLATVPMNLRHVSRD--FRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQF 430
            .|.:||:|||..:||::.:.|..|  |     ...|.:.:...|:...:.|.|.|..||.:.|:|
plant   398 QAALSETLRLYPSVPVDHKEVLEDDVF-----PDGTKLKKGEKVIYAIYAMGRMETIWGKDCREF 457

  Fly   431 DPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRH----SYSFLPFSNGLRSCIGRRYGLFIMKVFL 491
            .|:|:|                      ||.|:    :|.|..|:.|.|.|:|:.:..:.|:...
plant   458 KPERWL----------------------RDGRYMSESAYKFTAFNGGPRLCLGKDFAYYQMRYVA 500

  Fly   492 VKLITNFDFQSD 503
            ..:|..:..:.|
plant   501 AAIIYRYKVRVD 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 97/465 (21%)
AT5G08250NP_001330676.1 CYP86A 98..533 CDD:410687 98/467 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.