DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CPD

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_196188.1 Gene:CPD / 830453 AraportID:AT5G05690 Length:472 Species:Arabidopsis thaliana


Alignment Length:505 Identity:101/505 - (20%)
Similarity:174/505 - (34%) Gaps:167/505 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EKVSQYRVHFQRPLAVLVGTRVLLYIDDPAG----------MECVLNAPEC--LDKTFLQDGFFV 111
            |:|::|...|   :..|.|...:...|....          .||...|..|  |.|..|    .:
plant    62 ERVARYGSVF---MTHLFGEPTIFSADPETNRFVLQNEGKLFECSYPASICNLLGKHSL----LL 119

  Fly   112 RRGLLHARGQKWKLRRKQLNPAFSHNIVASF-----------FDV-----FNSVGNQMVEQFQTQ 160
            .:|.||.|               .|::..||           .|:     ||      ::.:.::
plant   120 MKGSLHKR---------------MHSLTMSFANSSIIKDHLMLDIDRLVRFN------LDSWSSR 163

  Fly   161 TNLHGQAVKFT---AAEDLL-------SRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEIS 215
            ..|..:|.|.|   ..:.|:       |.::.:...|.|.|    |..|.....:.:|::  .|.
plant   164 VLLMEEAKKITFELTVKQLMSFDPGEWSESLRKEYLLVIEG----FFSLPLPLFSTTYRK--AIQ 222

  Fly   216 AVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASN 280
            |.|.|...|.:.::.|      .||.::.|:..:|.:..:                         
plant   223 ARRKVAEALTVVVMKR------REEEEEGAERKKDMLAAL------------------------- 256

  Fly   281 GWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLAL-------LCLATNKGDC 338
                         |||:...:.|||:|...::::..:||.|..:.||:       |.||..|.:.
plant   257 -------------LAADDGFSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEH 308

  Fly   339 QRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIV 403
            ::     |||:..|...:.....:.:.:....|:|:||:...:....|....|..:.|.:    :
plant   309 EK-----IRAMKSDSYSLEWSDYKSMPFTQCVVNETLRVANIIGGVFRRAMTDVEIKGYK----I 364

  Fly   404 PQN-------SIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDR 461
            |:.       ..|.||..:.:        :||.|:|.|:   :...::.|               
plant   365 PKGWKVFSSFRAVHLDPNHFK--------DARTFNPWRW---QSNSVTTG--------------- 403

  Fly   462 RHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQF 511
             .|..|.||..|.|.|.|.......:.|||.:|:|.|.: ...|.:||.|
plant   404 -PSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSW-VPAEQDKLVF 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 97/495 (20%)
CPDNP_196188.1 p450 1..472 CDD:386267 101/505 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.