DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP702A6

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_680696.2 Gene:CYP702A6 / 827207 AraportID:AT4G15396 Length:475 Species:Arabidopsis thaliana


Alignment Length:478 Identity:92/478 - (19%)
Similarity:173/478 - (36%) Gaps:142/478 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMEC-----VLNAPECLDKTFLQDGFFVRR 113
            |..:.|||.::...|:   ..|.|.:|::..|....||.     :...|:.|.:.|..:..||.:
plant    61 PTFVKEKVLRHGPVFR---TSLFGGKVIISTDIGLNMEIAKTNHIPGMPKSLARLFGANNLFVNK 122

  Fly   114 GL-LHAR--------GQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVK 169
            .. .|||        .|..|||..|              |:          .|..:|:|...|.|
plant   123 DTHKHARSLTNQFLGSQALKLRMLQ--------------DI----------DFLVRTHLKEGARK 163

  Fly   170 FTA-AEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVV--------KPWLQ 225
            .:. .::..|:.::|.....:||.                   :|..|.:.:        :.|..
plant   164 GSLDIKETTSKIIIECLAKKVMGE-------------------MEPDAAKELTLCWTFFPREWFG 209

  Fly   226 IRL------LHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQR 284
            ...      ::|::     :...:..|:|::.|            |:....||:.|:        
plant   210 FAWNIPGTGVYRMV-----KARNRMMKVLKETV------------LKKRASGEELGD-------- 249

  Fly   285 RIFIEQIFQLAANGEMT--LEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIR 347
              |.:.||.....|..|  ||...:...::.|::.|| :.:::.|.:.|.::.....:.|..|..
plant   250 --FFKTIFGDTERGVKTISLESATEYIFTLFLLANET-TPAVLAATIKLISDHPKVMQELQREHE 311

  Fly   348 ALVPD------VGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQN 406
            .:|.|      ...:..|..:.:.:....::||||:.:|||..||.:..:|:..    |..:|..
plant   312 GIVRDKIEKNEKADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEFQFG----EYTIPAG 372

  Fly   407 SIVV---LDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFL 468
            .|.:   ...||.::.:     :...|:|.|:         ||.:.|..          .|.:::
plant   373 WIFMGYPYVHFNAEKYD-----DPLAFNPWRW---------KGKDLSAI----------VSRTYI 413

  Fly   469 PFSNGLRSCIGRRYGLFIMKVFL 491
            ||.:|.|.|:|..:....|.:|:
plant   414 PFGSGSRLCVGAEFVKLKMAIFI 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 92/478 (19%)
CYP702A6NP_680696.2 p450 9..454 CDD:299894 92/478 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.