DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP702A5

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:489 Identity:92/489 - (18%)
Similarity:177/489 - (36%) Gaps:153/489 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 INLH-----PNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMEC-----VLNAPECLDKTF 104
            :.||     |..:.||:.::...|:   ..|.|.:|::..|....||.     :...|:.|::.|
plant    52 MKLHDAIQLPTFVKEKLLRHGPVFR---TSLFGGKVIISTDIGLNMEIAKTNHIPGMPKSLERLF 113

  Fly   105 LQDGFFVRRGL-LHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAV 168
            .....||.:.. .|||                            |:.||.         |..||:
plant   114 GATNLFVNKDTHKHAR----------------------------SLTNQF---------LGSQAL 141

  Fly   169 KFTAAEDL--LSRAVLE----VSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIR 227
            |....:|:  |:|..::    ..||.:..|.:              |.::|..:.:|:..     
plant   142 KLRMIQDIDFLARTHMKEGARKGCLDVKETAS--------------KIVIECLSKKVMGE----- 187

  Fly   228 LLHRLLAPELYEESKKC--------AKLLEDFVG----GIVRTKHRNWR------LRDAVGGEKS 274
                 :.||..:|...|        .:...:|.|    .||:.::|..:      ::....|:|.
plant   188 -----MEPEAAKELTLCWTFFPRDWFRFAWNFPGTGVYRIVKARNRMMKVIKETVVKKRASGKKL 247

  Fly   275 GEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQ 339
            ||          |.|.||....:..|::|...:...::.:::.|| :..::.|.:.|.::.....
plant   248 GE----------FFETIFGDTESVTMSIEIATEYIFTLFVLANET-TPGVLAATIKLISDNPKVM 301

  Fly   340 RRLLAEIRALVPD------VGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQ 398
            :.|..|...:|.|      ...:..|..:.:.:....::||||:.:|||..||.:..:.:..   
plant   302 QELRREHEGIVQDKIKKDETADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEIQFG--- 363

  Fly   399 HETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLS------KGHNDSGSGEKRR 457
             :..:|...|             :.|.....|:|:::    ::.|:      ||.:.|....|  
plant   364 -DYTIPAGWI-------------FMGYPYVHFNPEKY----DDPLAFNPWRWKGKDLSTIVSK-- 408

  Fly   458 QRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFL 491
                    ::|||.:|.|.|:|..:....|.:|:
plant   409 --------TYLPFGSGTRLCVGAEFVKLQMAIFI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 92/489 (19%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 92/489 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.