DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP702A3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_193266.2 Gene:CYP702A3 / 827197 AraportID:AT4G15310 Length:475 Species:Arabidopsis thaliana


Alignment Length:580 Identity:103/580 - (17%)
Similarity:185/580 - (31%) Gaps:204/580 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IALWACGALLAVLLA-----WQQRKCWRLIWQLNGWRGVIQQPVLWLLLCINLHPNS----ILEK 60
            :||....:|:.|.|.     |...||          :|             .|.|.|    |:.:
plant     7 LALSVVFSLIVVKLCHWVYQWSNPKC----------KG-------------KLPPGSMGFPIIGE 48

  Fly    61 VSQYRVHFQRPLAV-------------------LVGTRVLLYIDDPAGMECV-----LNAPECLD 101
            ..::...|...|.|                   |.|.:|::.||....||..     |.|.|.:.
plant    49 TFEFMTPFDISLVVSPYLKKRISRYGSKVFRTSLFGAKVIVSIDPDVNMEIAKASSQLRATESVT 113

  Fly   102 KTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFF-------------------DVFN 147
            :.|.::..|::...:|               .:..|:.:.|.                   ||.|
plant   114 RIFGENNPFLQSKEIH---------------KYVRNLTSRFVGPEGLKTRLIHDIDNLLRNDVEN 163

  Fly   148 SVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLL 212
            ...|...:..:....:.|:.:......:..|.||.|:.                          |
plant   164 GARNGSFDVREATIKMVGELIAKKIMGETESEAVKELG--------------------------L 202

  Fly   213 EISAVRVVKPWLQI------RLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGG 271
            ..||.|.  .|.|.      ..::||:     :..:|.||||:..:            |:.....
plant   203 CWSAFRT--SWFQFSYNIPGTTVYRLV-----KARRKAAKLLKALI------------LKKKASK 248

  Fly   272 EKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSF---ETVSNSIMLALLCLAT 333
            |..|:          |::.||.........|:  :|:|.:::.|.|   :..:..:..|::.|..
plant   249 EGLGD----------FLDIIFDEMEKDGTALD--IDKAVNLIFVFFILSQETTPGVQGAVVKLVA 301

  Fly   334 NKGDCQRRLLAEIRALV-----PDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFR 393
            :.......|..|..|:|     .|.| |..|:.:.:.:....:.||||..:|.|...|       
plant   302 DHPSVMEELQREHEAIVQNRADKDTG-VTWEEYKSMTFTHMVIKESLRFTSTQPTVHR------- 358

  Fly   394 LAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLS--------KGHNDS 450
                     :|...:.:.| :.:.....::|.....||.:::    ::.|:        |..|.:
plant   359 ---------IPDQDVQIGD-YTLPAGWLFFGIPQVHFDEEKY----DDPLTFNPWRWQGKDINST 409

  Fly   451 GSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQ 510
            .|.|            ::||..|...|:|..:...|:.:.|..| :.|.:..|.:.|.|:
plant   410 VSRE------------YMPFGAGGTHCVGSEFAKLIIAILLHHL-SRFRWSLDPKTEVLR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 91/529 (17%)
CYP702A3NP_193266.2 p450 35..458 CDD:386267 94/529 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.