DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP97B3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_193247.2 Gene:CYP97B3 / 827177 AraportID:AT4G15110 Length:580 Species:Arabidopsis thaliana


Alignment Length:502 Identity:116/502 - (23%)
Similarity:201/502 - (40%) Gaps:78/502 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVL--NAPECLDKTFLQDGF--FVRRGLLHA 118
            ||....|::.|        |.:..:.|.||.....||  || ...||..|.:..  .:.:||:.|
plant   108 LEHGGIYKLAF--------GPKAFVVISDPIIARHVLRENA-FSYDKGVLAEILEPIMGKGLIPA 163

  Fly   119 RGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMV---EQF--QTQTNLHGQAVKFTAAEDLLS 178
            ....|||||:.:.|||....:.:...||:....:|:   |:.  :.:|:.....::.....:..|
plant   164 DLDTWKLRRRAITPAFHKLYLEAMVKVFSDCSEKMILKSEKLIREKETSSGEDTIELDLEAEFSS 228

  Fly   179 RAVLEVSCLTI----MGTPTN---------FTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLH 230
            .| |::..|::    .|:.|.         .|..:..|.:..|.........|    |:..|  .
plant   229 LA-LDIIGLSVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYFPYWNFPPAR----WIVPR--Q 286

  Fly   231 RLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGE-------DASNGWQRRIFI 288
            |....:|        |::.|.:.|:::.....   |.....||..|       |||   ..|..:
plant   287 RKFQSDL--------KIINDCLDGLIQNAKET---RQETDVEKLQERDYTNLKDAS---LLRFLV 337

  Fly   289 EQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDV 353
            :.     ...::...::.|:..:|::...||.:..:..|:..|:.|. :..|:..|||.|::.. 
plant   338 DM-----RGVDIDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLSQNP-EKIRKAQAEIDAVLGQ- 395

  Fly   354 GQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAG------RQHETIVPQNSIVVLD 412
            |....|.:::|.|:...|.|.|||....|:.:|...:...|.|      ..|:  ||:.:.:.:.
plant   396 GPPTYESMKKLEYIRLIVVEVLRLFPQPPLLIRRTLKPETLPGGHKGEKEGHK--VPKGTDIFIS 458

  Fly   413 TFNMQRDERWWGANARQFDPQRFLDQEEEQLSK---GHNDSGSGEKRRQRDRRHSYSFLPFSNGL 474
            .:|:.|...:|. |...|:|:|||..:|....:   |.:.|.|.......:....::||||..|.
plant   459 VYNLHRSPYFWD-NPHDFEPERFLRTKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGP 522

  Fly   475 RSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKN 521
            |.|||.::.|....|.|..|...||.:.....|.::.|...::..||
plant   523 RKCIGDQFALMESTVALAMLFQKFDVELRGTPESVELVSGATIHAKN 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 112/482 (23%)
CYP97B3NP_193247.2 PLN02738 45..580 CDD:215393 116/502 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.