DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP94D2

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_191222.1 Gene:CYP94D2 / 824830 AraportID:AT3G56630 Length:499 Species:Arabidopsis thaliana


Alignment Length:513 Identity:108/513 - (21%)
Similarity:207/513 - (40%) Gaps:126/513 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FQRPLAVLVGTRVLLYIDDPAGMECVLNAP-ECLDK-----TFLQDGFFVRRGLLHARGQKWKLR 126
            |:||     |....:...:||.:|.:|... |...|     :.|:|  |:.||:.::.|:.|..:
plant    68 FRRP-----GKLQFVMTANPANVEYMLKTKFESFPKGERFISILED--FLGRGIFNSDGEMWWKQ 125

  Fly   127 RKQLNPAFSHNIVASFF--DVFNSVGNQMVEQF-QTQTNLHGQAVKFTAAEDLLSRAV------- 181
            ||..:..||...:..|.  :|...:..::|... :..||  |:.:..   :|:|.|..       
plant   126 RKTASYEFSTKSLRDFVMSNVTVEINTRLVPVLAEAATN--GKLIDL---QDILERFAFDNICKL 185

  Fly   182 ---LEVSCLTIMGTP-TNFTQLDD-----------AHIAHSY--KRLLEISAVRVVKPWLQIRLL 229
               ::.:||...|.. .||.|..:           :.|::|:  |:.|.|.:.||::.  .|.::
plant   186 AFNVDSACLGDDGAAGVNFMQAFETAATIISQRFQSVISYSWKIKKKLNIGSERVLRE--SIMIV 248

  Fly   230 HRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQL 294
            |:                   |...|||.:....::.|      ..||.            :.:.
plant   249 HK-------------------FADEIVRNRIEQGKVSD------HKEDL------------LSRF 276

  Fly   295 AANGEMTLEEIM-DEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQ--- 355
            .:..||...||: |...|.:|...:|.|:::......|:.:. :.:.::|.|:.::....|:   
plant   277 ISKEEMNSPEILRDIVISFILAGRDTTSSALSWFFWLLSMHP-EVKDKILQELNSIRERTGKRIG 340

  Fly   356 --VGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLD------ 412
              .|.|.|:.:.||.|.::|||||...||::....:.|         .::|..:.:..|      
plant   341 EVYGFEDLKLMNYLHAAITESLRLYPPVPVDTMSCAED---------NVLPDGTFIGKDWGISYN 396

  Fly   413 TFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSC 477
            .:.|.|.|..||.:..:|||:|::|:.        |....||        :.|.|..|..|.|.|
plant   397 AYAMGRMESIWGKDCDRFDPERWIDET--------NGGFRGE--------NPYKFPAFHAGPRMC 445

  Fly   478 IGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPKKES 535
            :|:......||..:..::..|..:...:.|:.:.:.:::|:.:..    |.::.::.|
plant   446 LGKEMAYIQMKSIVAAVLERFVVEVPGKKERPEILMSVTLRIRGG----LNVRVQERS 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 104/479 (22%)
CYP94D2NP_191222.1 p450 52..499 CDD:299894 107/511 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.