DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP94B3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_190421.1 Gene:CYP94B3 / 824011 AraportID:AT3G48520 Length:506 Species:Arabidopsis thaliana


Alignment Length:487 Identity:117/487 - (24%)
Similarity:200/487 - (41%) Gaps:64/487 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QLNGWRGVIQQPVLWLLLCINLHPNSILEKVSQ-YRVH-FQRPLAVLVGTRVLLYIDDPAGMECV 93
            |.|...|....|::..:|..|.:.:.:|:..:: .|:. .|..|..|:|.|..:...:|..:|.:
plant    29 QENTTYGPPSYPLIGSILSFNKNRHRLLQWYTELLRLSPSQTILVPLLGNRRTIITTNPLNVEYI 93

  Fly    94 L-----NAPECLDKTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASF-FDVF-NSVGN 151
            |     |.|:....|.|. |..:..|:.:..|..|..:||..:..||...:.|| |:|. :.|.|
plant    94 LKTNFFNFPKGKPFTDLL-GDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLKDEVEN 157

  Fly   152 QMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMG---------TPTNFTQLDDAHIAHS 207
            ::|....|..:: |..|..   :|:|.|...:|.|...:|         .|.|       .:..:
plant   158 RLVPVLSTAADV-GTTVDL---QDVLKRFAFDVVCKVSLGWDPDCLDLTRPVN-------PLVEA 211

  Fly   208 YKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGE 272
            :....||||.|..:|...:....|:|......:.::..:.:...|..|||.|            :
plant   212 FDTAAEISARRATEPIYAVWKTKRVLNVGSERKLREAIRTVHVLVSEIVRAK------------K 264

  Fly   273 KSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGD 337
            ||.|..:....::..:.:......||    |.:.|...|.::...:|.| :.|..|..|.|...|
plant   265 KSLEIGTGAEAKQDLLSRFLAAGHNG----EAVRDMVISFIMAGRDTTS-AAMTWLFWLLTENDD 324

  Fly   338 CQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETI 402
            .:|::|.|:..|| .:| :|.|.|:::.|..|.:.|::||...|..:.:|.:.|..|   ...|.
plant   325 VERKILEEVDPLV-SLG-LGFEDLKEMAYTKACLCEAMRLYPPVSWDSKHAANDDVL---PDGTR 384

  Fly   403 VPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSF 467
            |.:...|....:.|.|.|..||.::.:|:|.|:.|.|            .|..|........|.|
plant   385 VKRGDKVTYFPYGMGRMETLWGTDSEEFNPNRWFDSE------------PGSTRPVLKPISPYKF 437

  Fly   468 LPFSNGLRSCIGRRYGLFIMKVFLVKLITNFD 499
            ..|..|.|.|:|:......||..:..:::.|:
plant   438 PVFQAGPRVCVGKEMAFMQMKYVVGSVLSRFE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 114/476 (24%)
CYP94B3NP_190421.1 p450 46..501 CDD:386267 113/470 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.