DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP702A8

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:465 Identity:89/465 - (19%)
Similarity:166/465 - (35%) Gaps:156/465 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIV 139
            |.|.:|::.:|:...||                                 :.:....|..:.:| 
plant     9 LFGGKVIISMDNELNME---------------------------------MAKTNRTPGITKSI- 39

  Fly   140 ASFFDVFNSVGNQMVEQFQTQTN-----LHGQAVKFTAAE--DLLSRAVLEVSC----LTIMGTP 193
            |..|...|::..|..|..:...|     |..|::|....|  |||:|..:|...    |.:..|.
plant    40 ARLFGEDNNLFLQSTESHKHVRNLTVQMLGSQSLKLRIMENIDLLTRTHMEEGARDGSLDVKETT 104

  Fly   194 TNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVR- 257
            :              |.|:|..|.:|:..          :.|   |.:||.|.....|..|..| 
plant   105 S--------------KILIECLAKKVMGE----------MEP---EAAKKLALCWRYFPSGWFRL 142

  Fly   258 ---------------TKHRNWRLRDAV-----GGEKSGEDASNGWQRRIFIEQIFQLAANGE--- 299
                           .|.....|::.|     .||:.||     :.:.||.|:      .||   
plant   143 PFNLPGIGVYNMMKARKRMKTLLKEEVLKKREAGEEFGE-----FSKIIFGEK------EGEKET 196

  Fly   300 MTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIR---ALVPD--VGQVGL- 358
            |:::.:::...:..:::.||....:...:..::.|.     :::.|::   |::.:  ..:.|| 
plant   197 MSMKNVIEYIYTFFVIANETTPRILAATVKFISENP-----KVMQELQREHAMIFENKSEEAGLT 256

  Fly   359 -EQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERW 422
             |..:.:.:.:..::||||:..|||:.||....|.::.                 .:.:.....:
plant   257 WEDYKSMTFTNMVINESLRISTTVPVILRKPDHDTKVG-----------------DYTIPAGWNF 304

  Fly   423 WGANARQFDPQRFLDQEEEQLS------KGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRR 481
            .|..:..|||.::    |:.|.      || ||         .|...|.:::||..|.|.|:|..
plant   305 MGYPSAHFDPTKY----EDPLEFNPWRWKG-ND---------LDAIVSTNYIPFGAGPRLCVGAY 355

  Fly   482 YGLFIMKVFL 491
            :...:|.:|:
plant   356 FAKLLMAIFI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 89/465 (19%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 89/465 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.