DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP94B2

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_566155.1 Gene:CYP94B2 / 821263 AraportID:AT3G01900 Length:496 Species:Arabidopsis thaliana


Alignment Length:496 Identity:105/496 - (21%)
Similarity:193/496 - (38%) Gaps:84/496 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PVLWLLLCINLHPNSILEKVSQYRVHFQRPLAVL--VGTRVLLYIDDPAGMECVL-----NAPEC 99
            ||:..|:....:.|.:|:..::..........|:  :..|..:...:|:.:|.:|     |.|: 
plant    36 PVIGCLISFYTNRNRLLDWYTELLTESPSRTVVIRRLAARRTVVTANPSNVEYILKTNFDNYPK- 99

  Fly   100 LDKTFLQD-GFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVF-NSVGNQMVEQFQTQTN 162
             .|.|.:. |.|:..|:.:..|..|..:|:.....|:...:..:..|. |.|..:::        
plant   100 -GKPFTEILGDFLGNGIFNVDGNLWLKQRRLATHDFTPKSLREYVTVLRNEVEKELL-------- 155

  Fly   163 LHGQAVKFTAAED--------LLSRAVLEVSCLTIMG------TPTN-FTQLDDAHIAHSYKRLL 212
                |....||||        ||.|....:.|:..:|      .|:: .::.|.|     ::...
plant   156 ----AFLNAAAEDSQPFDLQELLRRFTFNIVCIVFLGIDRCTLNPSSPVSEFDRA-----FQTAS 211

  Fly   213 EISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGED 277
            .:||.|...|...:....||:.....:|.:|....:.:.|..|:|.|.|              :.
plant   212 AVSAGRGSAPLSFVWKFKRLVGFGSEKELRKAVGEVHNCVDEIIRDKKR--------------KP 262

  Fly   278 ASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRL 342
            |:..:..|:.:.        ||.. |.:.|...|:::...:|.| ::...|..|.|...:.:..|
plant   263 ANQDFLSRLIVA--------GESD-ETVRDMVISIIMAGRDTTS-AVATRLFWLITGHEETEHDL 317

  Fly   343 LAEIRALVPDV-GQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQN 406
            ::|||::..:: |....|.|::|..|.|.:.|.:||...||.:.:|...|.||   ...|:|...
plant   318 VSEIRSVKEEITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRL---PDGTLVRAG 379

  Fly   407 SIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFS 471
            ..|....:.|.|.|..||.:..:|.|.|:.:..::...            |...:.:.:.|..|.
plant   380 DRVTYFPYGMGRMEELWGEDWDEFKPNRWAESYDKTCC------------RVLKKVNPFKFPVFQ 432

  Fly   472 NGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFV 512
            .|.|.|:|.......||..:..::..|:.: ....:|..||
plant   433 AGPRVCLGEEMAYVQMKYIVASILDRFEIE-PIPTDKPDFV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 102/485 (21%)
CYP94B2NP_566155.1 CYP86A 65..483 CDD:410687 100/467 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.