DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP72A14

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_188086.1 Gene:CYP72A14 / 820696 AraportID:AT3G14680 Length:512 Species:Arabidopsis thaliana


Alignment Length:512 Identity:115/512 - (22%)
Similarity:199/512 - (38%) Gaps:122/512 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WRGVIQQPVLWLLLCINLHPNSILE---KVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNA 96
            |.|.|  |.:.:     :.|..|.|   ||..::.....||:.::||                  
plant    99 WFGPI--PTITI-----MDPEQIKEVFNKVYDFQKAHTFPLSKILGT------------------ 138

  Fly    97 PECLDKTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQT 161
                             ||:...|.||...|:.:||||....:.:...||:...:::|.::....
plant   139 -----------------GLVSYDGDKWAQHRRIINPAFHLEKIKNMVHVFHESCSELVGEWDKLV 186

  Fly   162 NLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYK---RLLEISAVRVVKPW 223
            :..|.:.:......|.|... :|...|..|:              ||:   |:.|:.|...   .
plant   187 SDKGSSCEVDVWPGLTSMTA-DVISRTAFGS--------------SYREGHRIFELQAELA---Q 233

  Fly   224 LQIRLLHRLLAP-ELY------EESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNG 281
            |.::...:...| .:|      ...|..|:.::|.:.||:     |.|.|....||...||... 
plant   234 LVMQAFQKFFIPGYIYLPTKGNRRMKTAAREIQDILRGII-----NKRERARESGEAPSEDLLG- 292

  Fly   282 WQRRIFIE-QIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAE 345
                |.:| .:.|...|| |:.|::|:|.:...|...||.|..::..::.|:.:: |.|.|...|
plant   293 ----ILLESNLGQTEGNG-MSTEDMMEECKLFYLAGQETTSVLLVWTMVLLSQHQ-DWQARAREE 351

  Fly   346 IRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVV 410
            ::.:..| .|...|.|.||:.:...:.|.|||...|....|.:.::.:|.    :..:|....:.
plant   352 VKQVFGD-KQPDTEGLNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMKLG----DLTLPGGVQIS 411

  Fly   411 LDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLR 475
            |....:.||...||.:|.:|.|:||.|    .|||.              .::..||.||:.|.|
plant   412 LPVLLVHRDTELWGNDAGEFKPERFKD----GLSKA--------------TKNQVSFFPFAWGPR 458

  Fly   476 SCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPK 532
            .|||:.:.|...|:.:..::..|.|:             :|..:.:|...::|:.|:
plant   459 ICIGQNFTLLEAKMAMSLILQRFSFE-------------LSPSYVHAPYTIITLYPQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 108/474 (23%)
CYP72A14NP_188086.1 p450 24..512 CDD:299894 115/512 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.