DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP76C3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_182082.2 Gene:CYP76C3 / 819166 AraportID:AT2G45580 Length:515 Species:Arabidopsis thaliana


Alignment Length:414 Identity:88/414 - (21%)
Similarity:163/414 - (39%) Gaps:101/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTN---LHGQAV-----KFTAAEDLLS 178
            :|:..:|.:.   .:.:.....|...|:..:.||:..:..|   ..|:|:     .|..:.:::|
plant   129 RWRFLKKTIT---KYLLSPQNLDAIQSLRMRKVEELVSLVNEFRERGEAIDLARASFVTSFNIIS 190

  Fly   179 RAVLEVSCLTIMGTPTNF------TQLDD-AHIAH-----SYKRLLEISAV------------RV 219
            .|:..|...|.....:::      ..|.| |.|.:     .|.|.|::...            ||
plant   191 NALFSVDLATYDSNSSSYEFHNTVVHLTDIAGIPNVGDYFQYMRFLDLQGTRKKAVLCIEKLFRV 255

  Fly   220 VKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQR 284
            .:.::..||..|....|  :|.|:.:.:  |.:..::....:|                      
plant   256 FQEFIDARLAKRFSRTE--KEPKEASSI--DMLDSLLDLTQQN---------------------- 294

  Fly   285 RIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLAL--LCLATNKGDCQRRLLAEIR 347
                        ..|:|:.::......:.:...:|.|:::..|:  |..:|.|   ..:..:|||
plant   295 ------------EAELTMNDLKHLLLDVFVAGTDTNSSTMEWAMTELFRSTEK---MVKAQSEIR 344

  Fly   348 ALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLD 412
            .::...|.|....:..|.||.|.|.|:|||....|:..|....|.::.|    .:||:|:.||::
plant   345 QVIGQNGFVQESDIPSLPYLQAIVKETLRLHPAAPLIPRKSESDVQIMG----FLVPKNTQVVVN 405

  Fly   413 TFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSC 477
            .:.:.||...| .|..:|:|:|||.:|.:  .||            ||    :..:||.:|.|.|
plant   406 VWAIGRDASVW-ENPMKFEPERFLLRETD--VKG------------RD----FELIPFGSGRRMC 451

  Fly   478 IGRRYGLFIMKVFLVKLITNFDFQ 501
            .|....|..|.:.|..|:.:||::
plant   452 PGISMALKTMHMVLASLLYSFDWK 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 88/414 (21%)
CYP76C3NP_182082.2 p450 48..506 CDD:299894 88/414 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.