DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:540 Identity:117/540 - (21%)
Similarity:214/540 - (39%) Gaps:114/540 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNIALWACGALLAVLLAWQQRKCW----RLIWQLNGWRGVIQQPVLWLL---------------L 48
            |::||..|.||:.:    |..|.:    ||:..|:.:.|   .|..|||               .
Mouse    14 LHLALVFCLALVLM----QAMKLYLRRQRLLRDLSPFPG---PPAHWLLGHQKFLQEDNMETLDE 71

  Fly    49 CINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPE------------CLD 101
            .:..||.:....|..::..|              ||.||...:..|:..:            |  
Mouse    72 IVKKHPCAFPCWVGPFQAFF--------------YIYDPDYAKIFLSRTDPKMQYLHQLLTPC-- 120

  Fly   102 KTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQ 166
                     :.||||:..|.:|...|..|.|||..:|:....|........|:::::........
Mouse   121 ---------IGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQET 176

  Fly   167 AVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKR----LLEISAVRVVKPWLQIR 227
            .::.....:|::   |::......|..|| .|::..:  .||.:    |.||.:.|:...|....
Mouse   177 TIEVFEHINLMT---LDIIMKCAFGQETN-CQINGTY--ESYVKATFELGEIISSRLYNFWHHHD 235

  Fly   228 LLHRLLAPE--LYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQ 290
            ::.: |:|:  .::|   ..|::..:...|::.:      :..:..:...:|....   :||::.
Mouse   236 IIFK-LSPKGHCFQE---LGKVIHQYTEKIIQDR------KKILKNQVKQDDTQTS---QIFLDI 287

  Fly   291 IFQLAANGEMTLE--EIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDV 353
            :....|..|....  ::..|..:.:....:..:.||...|.|||.|. :.|.|...|||:::.|.
Mouse   288 VLSAQAEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNP-EHQDRCRTEIRSILGDG 351

  Fly   354 GQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQR 418
            ..:..|||.::.|....:.|:|||:..||...|.:|:...|.....   :|....|||..:.:..
Mouse   352 SSITWEQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHS---LPAGMTVVLSIWGLHH 413

  Fly   419 DERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYG 483
            :...|. :.:.|||.||                   .:...|:||..:|||||:|.|:|||:::.
Mouse   414 NPAVWN-DPKVFDPLRF-------------------TKENSDQRHPCAFLPFSSGPRNCIGQQFA 458

  Fly   484 LFIMKVFLVKLITNFDFQSD 503
            :..:||.:..::.:|....|
Mouse   459 MLELKVAIALILLHFQVAPD 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 104/495 (21%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 106/503 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.