DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and cyp46a1.3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001038763.1 Gene:cyp46a1.3 / 692332 ZFINID:ZDB-GENE-060519-40 Length:491 Species:Danio rerio


Alignment Length:458 Identity:98/458 - (21%)
Similarity:179/458 - (39%) Gaps:100/458 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HPNSIL----EKVSQ-YRV---HFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQD-- 107
            |.|.:|    ||... ||:   |:           |::.:..|...:.::.:|:.|...|:..  
Zfish    63 HMNDLLLIWAEKYGPVYRLNSFHY-----------VIINVHCPEATKTIMMSPKYLKDPFIYKRL 116

  Fly   108 -GFFVRR----GLLHARGQK-WKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQ 166
             |.|.:|    ||:.|.... |..:|:.::||||.:.:......||.:..:::::      |...
Zfish   117 FGLFGKRFLGYGLVTATDHDIWYRQRRIMDPAFSSSYLRGLISTFNEMSERLMDK------LEEM 175

  Fly   167 AVKFTAA--EDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKP------- 222
            |:..|.|  .||::...|::.|....|...|..:..|.....:.::.|:...:.:..|       
Zfish   176 AINKTPAVMHDLVNCVTLDIICKVAFGVDLNLFKQTDNPFQQAIEQCLQGMVLDLRDPFCKFFPK 240

  Fly   223 -WLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI 286
             |..|            :|:|....||        |.....| :::.....:.|||..|.     
Zfish   241 NWKAI------------QETKGATVLL--------RKTGEQW-IQNRKTAVEIGEDVPND----- 279

  Fly   287 FIEQIFQLA----ANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIR 347
            .:.||.:.|    .|.....|:::|...:..:...||.:|.:..|::.|..:. :..:|..||:.
Zfish   280 ILTQILKTAKEEKVNNTKDHEQMLDNFVTFFIAGQETTANQLSFAIMELGRHP-EIYKRAKAEVD 343

  Fly   348 ALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLD 412
            .::.....:..|.|.:..||...:.|:|||..|.|...|.:..|..:.|.:    :|....|:..
Zfish   344 EVLGTKRDISYEDLGKFTYLSQVLKETLRLYPTAPGTNRWLHEDMVINGIK----IPGGISVIFS 404

  Fly   413 TFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSC 477
            ::..||.|:.: .:..:|||:||                     .....:..|.:.|||.|.|||
Zfish   405 SYVAQRLEKHF-KDPLKFDPERF---------------------NVNAPKPYYCYYPFSLGPRSC 447

  Fly   478 IGR 480
            :|:
Zfish   448 LGQ 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 98/458 (21%)
cyp46a1.3NP_001038763.1 p450 39..452 CDD:278495 98/458 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.