DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP4F12

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:564 Identity:135/564 - (23%)
Similarity:230/564 - (40%) Gaps:111/564 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNIALWACGALLAVLLAWQ---QRKCWRLIWQLNGWRGVIQQPV----LWLLLCINLHPNSILEK 60
            |.:..|    |||.:|||.   ...|.||        ....||.    .|..|.:.......|:.
Human    24 LVVGSW----LLARILAWTYAFYNNCRRL--------QCFPQPPKRNWFWGHLGLITPTEEGLKN 76

  Fly    61 VSQYRVHFQRPLAVLVGTRV-LLYIDDPAGMECVLNAPECLDKTFLQDGFFVR-------RGLLH 117
            .:|....:.:...|.:|..: .:.:..|..:..:.||...:..   :|..|:|       .|:|.
Human    77 STQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAP---KDNLFIRFLKPWLGEGILL 138

  Fly   118 ARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVL 182
            :.|.||...|:.|.|||..||:.|:..:||...|.|::::|           ..|:|......:.
Human   139 SGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQ-----------HLASEGSSRLDMF 192

  Fly   183 E-VSCLTIMGTPTNFTQLDDAHIAHSYKR-------LLEISAVRVVKPWLQIRLLHRLLAPELYE 239
            | :|.:|:..........|    :|..:|       :||:||  :|:...|..|.|......|..
Human   193 EHISLMTLDSLQKCIFSFD----SHCQERPSEYIATILELSA--LVEKRSQHILQHMDFLYYLSH 251

  Fly   240 ESK---KCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGE-- 299
            :.:   :..:|:.||...::|.:.|....:   |.:...:|.:.. :...||:.:  |.:..|  
Human   252 DGRRFHRACRLVHDFTDAVIRERRRTLPTQ---GIDDFFKDKAKS-KTLDFIDVL--LLSKDEDG 310

  Fly   300 --MTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVP--DVGQVGLEQ 360
              ::.|:|..||.:.:....:|.::.:...|..||.:. :.|.|...|::.|:.  |..::..:.
Human   311 KALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHP-EYQERCRQEVQELLKDRDPKEIEWDD 374

  Fly   361 LQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWG 424
            |.||.:|...|.|||||....|...|..::|..|. ||    ::|:....::|...:..:...| 
Human   375 LAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGR----VIPKGITCLIDIIGVHHNPTVW- 434

  Fly   425 ANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKV 489
            .:...:||.|| |.|.   |||               |...:|:|||.|.|:|||:.:.:..|||
Human   435 PDPEVYDPFRF-DPEN---SKG---------------RSPLAFIPFSAGPRNCIGQAFAMAEMKV 480

  Fly   490 FLVKLITNFDFQSDF-----ELEKLQFVE----------NISLK 518
            .|..::.:|.|..|.     :||.:...|          |:||:
Human   481 VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 116/490 (24%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 120/504 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.