DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP4F11

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:551 Identity:129/551 - (23%)
Similarity:220/551 - (39%) Gaps:156/551 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAVLLAWQQR---KCWRL-----------IWQLNGWRGVI------------------QQPVLW 45
            |||.:|||...   .|.||           .|   |.:|::                  |...||
Human    30 LLARVLAWTYTFYDNCRRLQCFPQPPKQNWFW---GHQGLVTPTEEGMKTLTQLVTTYPQGFKLW 91

  Fly    46 -------LLLCINLHPNSILEKVSQYRVHFQRPL----AVLVGTRVLLYIDDPAGMECVLNAPEC 99
                   |:||   ||:.|            ||:    |.:....::.|                
Human    92 LGPTFPLLILC---HPDII------------RPITSASAAVAPKDMIFY---------------- 125

  Fly   100 LDKTFLQDGF---FVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQT 161
                    ||   ::..|||.:.|.||...|:.|.|||..||:..:..:||...|.|.:::|.  
Human   126 --------GFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR-- 180

  Fly   162 NLHGQAVKFTAAEDLLSRAVLEVSCLT-------IMGTPTNFTQLDDAHIAHSYKRLLEISAVRV 219
                .|.:.:|..|:..    .:|.:|       :....:|..:....:||    .:||:||. |
Human   181 ----LASEGSARLDMFE----HISLMTLDSLQKCVFSFESNCQEKPSEYIA----AILELSAF-V 232

  Fly   220 VKPWLQIRLLHR----LLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASN 280
            .|...|| |||.    .|.|: .:..::...|:.||...:::.:      |..:..:...:...|
Human   233 EKRNQQI-LLHTDFLYYLTPD-GQRFRRACHLVHDFTDAVIQER------RCTLPTQGIDDFLKN 289

  Fly   281 GWQRRI--FIEQIFQLAAN---GEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQR 340
            ..:.:.  ||: :..|:.:   .|::.|:|..||.:.:....:|.::.:...|..||.:. :.|.
Human   290 KAKSKTLDFID-VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHP-EYQE 352

  Fly   341 RLLAEIRALVPDVGQVGLE--QLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETI 402
            :...|::.|:.|...:.:|  .|.||.:|...:.|||||...||:..|..::||.|. ||    :
Human   353 QCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGR----V 413

  Fly   403 VPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSF 467
            :|:..:.:::...:..:...| .:...:||.|| |||..:                  .|...:|
Human   414 IPKGIVCLINIIGIHYNPTVW-PDPEVYDPFRF-DQENIK------------------ERSPLAF 458

  Fly   468 LPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498
            :|||.|.|:|||:.:.:..|||.|...:.:|
Human   459 IPFSAGPRNCIGQAFAMAEMKVVLALTLLHF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 116/490 (24%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 120/529 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.