DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4f1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_062569.2 Gene:Cyp4f1 / 56266 RGDID:70926 Length:524 Species:Rattus norvegicus


Alignment Length:535 Identity:124/535 - (23%)
Similarity:208/535 - (38%) Gaps:104/535 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVL-WLLLCINLHP------NSILEKVSQ 63
            |.|....:|..:.| ..|...||       ||..|.|.. ||:..:.:..      ..:...|..
  Rat    27 ASWILAQILTQIYA-AYRNFRRL-------RGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGT 83

  Fly    64 YRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFF-------VRRGLLHARGQ 121
            |...|...:..:|....|.:.|.   :..:|||...:   .|:|..|       :..|||.:.|.
  Rat    84 YPQGFLMWIGPMVPVITLCHSDI---VRSILNASAAV---ALKDVIFYTILKPWLGDGLLVSAGD 142

  Fly   122 KWKLRRKQLNPAFSHNIVASFFDVFNSVGN-------QMVEQFQTQTNLHGQAVKFTAAEDLLSR 179
            ||...|:.|.|||..||:..:..:||...|       :::.:..::.::.......|.  |.|.:
  Rat   143 KWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWKRLISEGSSRLDMFEHVSLMTL--DSLQK 205

  Fly   180 AVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAV---RVVKPWLQIRLLHRLLAPELYEES 241
            .|....        :|..:....:||    .:||:||:   |..:|.|.:.||:. |.|:.....
  Rat   206 CVFSFD--------SNCQEKSSEYIA----AILELSALVAKRHQQPLLFMDLLYN-LTPDGMRFH 257

  Fly   242 KKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGED---ASNGWQRRIFIEQIFQLAAN---GEM 300
            |.| .|:.:|...::|.:.|.  |.|      .|.|   .|....:.:....:..|..:   .|:
  Rat   258 KAC-NLVHEFTDAVIRERRRT--LPD------QGLDEFLKSKAKSKTLDFIDVLLLTKDEDGKEL 313

  Fly   301 TLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALV--PDVGQVGLEQLQQ 363
            :.|:|..||.:.:....:|.::.:...|..||.:. :.|.|...|::.|:  .|..::..:.|.|
  Rat   314 SDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHP-EYQERCRQEVQELLRDRDPEEIEWDDLAQ 377

  Fly   364 LRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWG--- 424
            |.:|...:.|||||...|.:..|..::|..|. ||    .:|:..|.::..|.:..:...|.   
  Rat   378 LPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGR----TIPKGIICLISIFGIHHNPSVWPDPE 438

  Fly   425 -ANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMK 488
             .|..:|||:...|..                        ..:|:|||.|.|:|||:.:.:..||
  Rat   439 VYNPFRFDPENIKDSS------------------------PLAFIPFSAGPRNCIGQTFAMSEMK 479

  Fly   489 VFLVKLITNFDFQSD 503
            |.|...:..|....|
  Rat   480 VALALTLLRFRLLPD 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 113/497 (23%)
Cyp4f1NP_062569.2 CYP4F 74..515 CDD:410772 111/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.