DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and cyp4f2

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:510 Identity:117/510 - (22%)
Similarity:224/510 - (43%) Gaps:92/510 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WLL--LCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECL---DKTF 104
            |||  |.:.:.....|.::|....:.:|.|...:|....:.:..|..::.|:.|...:   |:.|
 Frog    67 WLLGHLGMFMPTEEGLTEISSAICNLRRTLLTWLGPIPEVSLVHPDTVKPVVAASAAIAPKDELF 131

  Fly   105 LQDGF---FVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQ 166
            .  ||   ::..|||.:||:||...|:.|.|||..:|:.::..:||...:.|:.:::..|     
 Frog   132 Y--GFLRPWLGDGLLLSRGEKWGQHRRLLTPAFHFDILKNYVKIFNQSTDIMLAKWRRLT----- 189

  Fly   167 AVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDA--------HIAHSYKRLLEISAVRVVKPW 223
                  ||..:|..:.|...|..:.|....|...|:        :|:..|    |:|:       
 Frog   190 ------AEGPVSLDMFEHVSLMTLDTLLKCTFSYDSDCQEKPSDYISAIY----ELSS------- 237

  Fly   224 LQIRLLHRLLAPELYE----------ESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGED- 277
            |.::..|.|  |..::          :.::..|.:.:|..|:|:.:.:..:       ||..|: 
 Frog   238 LVVKREHYL--PHHFDFIYNLSSNGRKFRQACKTVHEFTAGVVQQRKKALQ-------EKGMEEW 293

  Fly   278 -ASNGWQRRIFIEQIFQLAAN---GEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDC 338
             .|...:.:.||: |..|:.|   .:::.|::..|..:.:....:|.::.:...|..||.:. :.
 Frog   294 IKSKQGKTKDFID-ILLLSKNEDGSQLSDEDMRAEVDTFMFEGHDTTASGLSWILYNLACHP-EY 356

  Fly   339 QRRLLAEIRALV--PDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHET 401
            |.:...||..|:  .|:..:..::|.:|.:....:.|||||...|...:|..:.|.:|   ....
 Frog   357 QEKCRKEITELLEGKDIKHLEWDELSKLPFTTMCIKESLRLHPPVVAVIRRCTEDIKL---PKGD 418

  Fly   402 IVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYS 466
            |:|:.:..:::.|.:..:...| .|.:.:||.|| |.|..|                  .|.||:
 Frog   419 ILPKGNCCIINIFGIHHNPDVW-PNPQVYDPYRF-DPENLQ------------------ERSSYA 463

  Fly   467 FLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKN 521
            |:|||.|.|:|||:.:.:..||:.|..::.||..:.| |.:.::....:.|:.:|
 Frog   464 FVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLD-ETKTVRRKPELILRAEN 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 113/490 (23%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 115/504 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.