DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and cyp4f22

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_012812356.1 Gene:cyp4f22 / 548527 XenbaseID:XB-GENE-5889578 Length:545 Species:Xenopus tropicalis


Alignment Length:585 Identity:124/585 - (21%)
Similarity:243/585 - (41%) Gaps:132/585 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNIALWACGALLAVLLAWQQRKCW----RLIWQLNGWRGVIQQPVLWLLL----CINLHPNSI-L 58
            |.:|::    :.|.::..::.:|:    |..|.| |..|:..|....|||    |:...|... |
 Frog    40 LKMAIY----IYAYIINARRLRCFPEPPRRSWLL-GHLGLHPQICALLLLLCCHCLQFMPTEEGL 99

  Fly    59 EKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECL---DKTFLQDGF---FVRRGLLH 117
            .:||....:|::.....:|...|:.:..|..::.::.|...:   |:.|.  ||   ::..|||.
 Frog   100 TEVSNTISNFRKSFLTWMGPISLVSMVHPDTIKPMVAASAAIAPKDELFY--GFLRPWLGDGLLL 162

  Fly   118 ARGQKWKLRRKQLNPAFSHNIVASFFDVFN--------------SVGNQMVEQFQTQTNLHGQAV 168
            :||:||..:|:.|.|||..:|:.::..:||              :||...::.|:     |   |
 Frog   163 SRGEKWGRQRRLLTPAFHFDILKNYVKIFNQSTDIMLAKWRRLAAVGPVSLDMFE-----H---V 219

  Fly   169 KFTAAEDLLS-----------------RAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISA 216
            .....:.||.                 .|:.|:|.|.:.         .:.::.|.:..:..:|:
 Frog   220 SLMTLDTLLKCTFSYDSDCQEKPSDYIAAIYELSSLVVK---------REHYLPHHFDFIYNLSS 275

  Fly   217 VRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGED--AS 279
                    ..|..|            :..|.:.:|..|:|:.:.:..:       ||..|:  .|
 Frog   276 --------NGRKFH------------QACKTVHEFTAGVVQQRKKALQ-------EKGIEEWIKS 313

  Fly   280 NGWQRRIFIEQIFQLAAN---GEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRR 341
            ...:.:.||: |..|:.:   .:::.|::..|..:.:....:|.::.:...|..||.:. :.|.:
 Frog   314 KQGKTKDFID-ILLLSKDEDGNQLSDEDMRAEVDTFMFEGHDTTASGLSWILYNLACHP-EYQEK 376

  Fly   342 LLAEIRALV--PDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVP 404
            ...||..|:  .|...:..::|.||.:....:.|||||...|....|..:.|.:|...:   ::|
 Frog   377 CRKEITELLEGKDTKHLEWDELSQLPFTTMCIKESLRLHPPVTAVSRRCTEDIKLPDGK---VIP 438

  Fly   405 QNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLP 469
            :.:..::..:....:...| .|.:.:||.|| |.|:.|                  .|.|::|:|
 Frog   439 KGNSCLISIYGTHHNPDVW-PNPQVYDPYRF-DPEKLQ------------------ERSSHAFVP 483

  Fly   470 FSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPKKE 534
            ||.|.|:|||:.:.:..||:.|...:.||..:.| |.:.::....:.|:.:|.  :.|.::..|:
 Frog   484 FSAGPRNCIGQNFAMAEMKIVLALTLYNFYMRLD-ETKTVRRKPELILRAENG--LWLQVEELKQ 545

  Fly   535  534
             Frog   546  545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 108/509 (21%)
cyp4f22XP_012812356.1 p450 60..530 CDD:278495 116/542 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.