DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp12a4

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster


Alignment Length:571 Identity:128/571 - (22%)
Similarity:211/571 - (36%) Gaps:145/571 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WQQRKCWRLIWQLNGWRGVIQQPVLWLLLCI------NLHPNSILEKVSQ-YRVHFQRPLAVLVG 77
            |.|.|.:..|.:||.|       .|.:.:.:      |:....:.|.:.| |...|..|  .::|
  Fly    41 WLQAKPFEQIPRLNMW-------ALSMKMSMPGGKYKNMELMEMFEAMRQDYGDIFFMP--GIMG 96

  Fly    78 TRVLLYIDDPAGMECVL-------NAP---------ECLDKTFLQDGFFVRRGLLHARGQKWKLR 126
            ....|...:|...|.|.       |.|         |...|.|.|...    |::..:|:.|...
  Fly    97 NPPFLSTHNPQDFEVVFRNEGVWPNRPGNYTLLYHREEYRKDFYQGVM----GVIPTQGKPWGDF 157

  Fly   127 RKQLNPAFSH-NIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIM 190
            |..:||.... ..|..::...:.|..:.|::                        :||:.....:
  Fly   158 RTVVNPVLMQPKNVRLYYKKMSQVNQEFVQR------------------------ILELRDPDTL 198

  Fly   191 GTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDF--VG 253
            ..|.:|....:.....|      :|.|.:.|   |:.||..   .....|:.|....|::|  |.
  Fly   199 EAPDDFIDTINRWTLES------VSVVALDK---QLGLLKN---SNKESEALKLFHYLDEFFIVS 251

  Fly   254 GIVRTKHRNW---------RLRDAVGG-------------EKSGEDASNGWQRRIFIEQIFQLAA 296
            ..:..|...|         ||..|:.|             |:..::|..|..|          ..
  Fly   252 IDLEMKPSPWRYIKTPKLKRLMRALDGIQEVTLAYVDEAIERLDKEAKEGVVR----------PE 306

  Fly   297 NGEMTLEEIMD--------EAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDV 353
            |.:..||:::.        .|..|::...:|.|::....|||||.|. :.|.||..|:..::|:.
  Fly   307 NEQSVLEKLLKVDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNP-EKQARLREEVMKVLPNK 370

  Fly   354 GQVGLE-QLQQLRYLDAFVSESLRLLATVPMNLRHVSRD-----FRLAGRQHETIVPQNSIVVLD 412
            .....| .::.:.||.|.:.||.||...:..|.|.::||     :|:....:..|||.|::.   
  Fly   371 NSEFTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDAVLSGYRVPAGTYVNIVPLNALT--- 432

  Fly   413 TFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSC 477
                 |||  :...|.:|.|:|:|        :...||.|.....:....:.:.||||..|.|.|
  Fly   433 -----RDE--YFPQASEFLPERWL--------RSPKDSESKCPANELKSTNPFVFLPFGFGPRMC 482

  Fly   478 IGRRYGLFIMKVFLVKLITNFDFQSDFELEK-----LQFVENISLKFKNAD 523
            :|:|.....:::...:||.||:.:.::..|.     |..:.||.||||..|
  Fly   483 VGKRIVEMELELGTARLIRNFNVEFNYPTENAFRSALINLPNIPLKFKFID 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 112/522 (21%)
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 117/529 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.