DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp12e1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster


Alignment Length:507 Identity:108/507 - (21%)
Similarity:200/507 - (39%) Gaps:103/507 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVL---------NAPECLD------KTFLQD 107
            |:...||...|:.|  .:.||.::|.: :|...|.:.         .:.|.:|      :..:.|
  Fly    69 LDMNRQYGSIFRMP--SVAGTDLVLTM-NPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFD 130

  Fly   108 GFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTA 172
            |:   .||....|..|...|..:||.......|..: :.|.|  |:.::|..:..:....|....
  Fly   131 GY---DGLTSGNGPAWGKMRTAVNPILLQPRNAKLY-MTNLV--QVSDEFLERIRIIRDPVTQEM 189

  Fly   173 AEDL---LSRAVLEVSC-------LTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKP--WLQ 225
            .:|.   :...|:|..|       |.::|...|  ..|...:..:.:.::|:.....:.|  |  
  Fly   190 PDDFAVDIRHLVIESICSVALNTHLGLLGEQRN--NKDIQKLVLALQDVVELGFQLDIMPAFW-- 250

  Fly   226 IRLLHRLLAPELYEESKKCAKLLEDF----VGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI 286
                 :.|....:::..:....:.||    :|..::               :..|||..|....|
  Fly   251 -----KYLPMPNFKKLMRSLDTITDFCYFHIGNALK---------------RIEEDAKAGTLNEI 295

  Fly   287 FIEQIFQLAANGEMTLEEIMD-EAQSMVLVSFETV-----SNSIMLALLCLATNKG-DCQRRLLA 344
            .:|         ...||::.. :.|:.|:::.:.:     ...:.|..:..:.:|. |.|.|||.
  Fly   296 GLE---------TSLLEKLARFDRQTAVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLE 351

  Fly   345 EIRALVPDV-GQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSI 408
            |||.::|:. ..:.:|.::.|.||.|.:.|.:|:....|..||.:..|..|:|.:   :|....:
  Fly   352 EIRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYR---VVAGTDV 413

  Fly   409 VVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNG 473
            .:...:.|...|: :....|:|.|:|:|..|......|...:             .:.:|||..|
  Fly   414 GIAANYQMANMEQ-FVPKVREFIPERWLRDESNSHLVGETAT-------------PFMYLPFGFG 464

  Fly   474 LRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELE---KLQFV--ENISLKFK 520
            .|||.|:|....::::.:.:|:.||....|:.:|   |.||.  .||..|||
  Fly   465 PRSCAGKRIVDMMLEIAISRLVRNFKIGFDYPIENAFKAQFFVQPNIPFKFK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 98/483 (20%)
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 108/507 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.