DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP4F3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:561 Identity:130/561 - (23%)
Similarity:219/561 - (39%) Gaps:145/561 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIALWACGA-------------LLAVLLAWQQR---KCWRLIWQLNGWRGVIQQPVL-WLLLCIN 51
            ::.||...|             |||.:|||...   .|.||       |...|.|.. |.|..:.
Human     8 SLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRL-------RCFPQPPKRNWFLGHLG 65

  Fly    52 L-HPNSILEKVSQYRVHFQRPLAVLVGT---------RVLLYIDDPAGMECVLNAPECL---DKT 103
            | |.       |:..:.:.:.||...|.         ..::.|..|..::.||.||..:   ||.
Human    66 LIHS-------SEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKV 123

  Fly   104 FLQDGFFVR----RGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLH 164
            |..   |::    .|||.:.|:||...|:.|.|||..||:..:..:||...|.|..::|.     
Human   124 FYS---FLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL----- 180

  Fly   165 GQAVKFTAAEDLLSRAVLEVSCLT-------IMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKP 222
             .|.:.:|..|:..    .:|.:|       :....::..:....:||    .:||:||: |.|.
Human   181 -LASEGSARLDMFE----HISLMTLDSLQKCVFSFDSHCQEKPSEYIA----AILELSAL-VTKR 235

  Fly   223 WLQIRLLH----RLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQ 283
            ..|| ||:    ..|.|: .:..::..:|:.||...:::.:.|..              .|.|  
Human   236 HQQI-LLYIDFLYYLTPD-GQRFRRACRLVHDFTDAVIQERRRTL--------------PSQG-- 282

  Fly   284 RRIFIEQIFQLAANG------------------EMTLEEIMDEAQSMVLVSFETVSNSIMLALLC 330
                ::...|..|..                  :::.|:|..||.:.:....:|.::.:...|..
Human   283 ----VDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYH 343

  Fly   331 LATNKGDCQRRLLAEIRALVPD--VGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFR 393
            ||.:. :.|.|...|::.|:.|  ..::..:.|.||.:|...:.|||||...||...|..::|..
Human   344 LAKHP-EYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIV 407

  Fly   394 LA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRR 457
            |. ||    ::|:..|.::..|....:...| .:...:||.||..:..::               
Human   408 LPDGR----VIPKGIICLISVFGTHHNPAVW-PDPEVYDPFRFDPKNIKE--------------- 452

  Fly   458 QRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498
                |...:|:|||.|.|:|||:.:.:..|||.|...:..|
Human   453 ----RSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 116/507 (23%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 117/510 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.