DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4d8

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster


Alignment Length:528 Identity:123/528 - (23%)
Similarity:241/528 - (45%) Gaps:55/528 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNIALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLL-LCINLHPNSILEKVSQYRV 66
            |.:.|:..|.::.:..|.::||...|       .|.|..|::..: |.:.|:|.:.::...:|.:
  Fly     6 LVVLLFGAGWIIHLGQADRRRKVANL-------PGPICPPLIGAMQLMLRLNPKTFIKVGREYVL 63

  Fly    67 HFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDK--TFLQDGFFVRRGLLHARGQKWKLRRKQ 129
            .|.....|.:..|:|:...|....|.:|::.|.|.|  .:...|.::..|||.:.|:.|..|||.
  Fly    64 KFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKI 128

  Fly   130 LNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPT 194
            :.|.|..:|:..|.:||:...|..|::...:.|  |..  |.....:.: |.|::...|.|||..
  Fly   129 ITPTFHFSILEQFVEVFDQQSNICVQRLAQKAN--GNT--FDVYRSICA-AALDIIAETAMGTKI 188

  Fly   195 NFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTK 259
            .....:....|.:......:.:.|.:..:||:.||..|..|.|.....:..:.:::|...::  :
  Fly   189 YAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIRTMQEFTIKVI--E 251

  Fly   260 HRNWRLRDAVGGEKSGEDASNGWQRRI-FIEQIFQLAANGE-MTLEEIMDEAQSMVLVSFETVSN 322
            .|...|.|.........|...|.:||: .::.:.....:|. :|.:||.:|..:.:....:|.::
  Fly   252 KRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIREEVDTFMFEGHDTTTS 316

  Fly   323 SIMLALLCLATNKGDCQRRLLAEI-RALVPDVGQ-VGLEQLQQLRYLDAFVSESLRLLATVPMNL 385
            ::...|..|:.:. :.|.::|.|| :.|..|..: |.:..|.:|:|::..:.||||:...||:..
  Fly   317 ALSFCLHELSRHP-EVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVG 380

  Fly   386 RHVSRDFRLAGRQH-ETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHND 449
            |.:..||:.....| :.::|..|.:::..|.:.|....: .|..:|.|:|             ::
  Fly   381 RKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETF-PNPDEFIPER-------------HE 431

  Fly   450 SGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFEL----EKLQ 510
            :||        |...:..:|||.|.|:|||:::....||:.|.|::      .::||    ::::
  Fly   432 NGS--------RVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIV------REYELLPMGQRVE 482

  Fly   511 FVENISLK 518
            .:.||.|:
  Fly   483 CIVNIVLR 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 109/468 (23%)
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 108/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.