DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:591 Identity:126/591 - (21%)
Similarity:228/591 - (38%) Gaps:175/591 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLLL-----CINLHPNSILEKVSQYR 65
            |.:.|..|.:....::.|:...||..|.|       |..|.|:     .:.|.|.:..::.::|.
  Fly     5 ATFICFCLASAFNYFRARRQRSLIKNLKG-------PFTWPLMGAMHKLLFLTPINFFQRSTEYL 62

  Fly    66 VH---------FQR---PLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRR----- 113
            ..         |.|   |||.|..:|.||..|                 |.|:.|:.:.:     
  Fly    63 TKYGTFSRCWVFHRLFIPLADLELSRQLLEND-----------------THLETGYELMKDWLVG 110

  Fly   114 GLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDL-- 176
            |:|..:.::|:.|         |::::..||..|.  .|:::..:.||....|.:...|.:.:  
  Fly   111 GVLMCQSEQWQKR---------HSLISGLFDKGNL--EQLIDLSRHQTEQLLQKLAKQADQKVFD 164

  Fly   177 ----LSRAVLEVSCLTIMGT-PT-----NFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHR 231
                :|..||::..:|..|. |:     |...|.:.:    .||.|.:.:......||.      
  Fly   165 IWYTVSPIVLDLMVMTTCGAKPSEEYSKNLKDLSEIY----RKRFLSLQSANRFNYWLS------ 219

  Fly   232 LLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIE---QIFQ 293
              :|.:.:...:..|.|.|        :|.|..             |.:..|.::.||   .|:|
  Fly   220 --SPFMRKRQNRLIKRLND--------EHNNLM-------------AMHQSQNQLKIENGLDIYQ 261

  Fly   294 L-----------------AANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRR 341
            |                 :.:.::|.|||..|..:...:.::..|.::...|:.:|.|. ..|::
  Fly   262 LRPIPLKDHKSLLEILLESKDPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNP-SVQQK 325

  Fly   342 LLAEIR-ALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETI--- 402
            .|.|:. |.:.|.|.    .|::|.||||.:.|::||.....:..|.:.:||...   |..:   
  Fly   326 CLDELNLAQIKDQGW----DLEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYT---HSIVGDA 383

  Fly   403 -VPQNSIVVLDTFNMQRDE-RWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSY 465
             :|..|.:.::.:.:||:| |:..||  .||.|||||...|.||                     
  Fly   384 ELPCGSEIYINLYELQRNEVRYPKAN--HFDAQRFLDSPPELLS--------------------- 425

  Fly   466 SFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFK----NADDIL 526
                :|.|.|.|..|::.:.::|..|..::.||        |.|.:.:.:.|..:    :::...
  Fly   426 ----YSLGPRCCPARKFSMQLLKTLLAPILANF--------EVLPYGDEVRLDLRLVLGSSNGFQ 478

  Fly   527 LTIQPK 532
            |.::|:
  Fly   479 LALKPR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 113/520 (22%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 116/543 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.