DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4aa1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster


Alignment Length:438 Identity:104/438 - (23%)
Similarity:204/438 - (46%) Gaps:63/438 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LVGTRVLLY----IDDPAGMECVLNAPECLDKTFLQDGF--FVRRGLLHARGQKWKLRRKQLNPA 133
            ||...|||:    :.:|..::.:|::.:..:|.|.....  |:..||:.:.|.||...|:.:.||
  Fly    83 LVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVFFYRLMHNFLGDGLITSSGSKWSNHRRLIQPA 147

  Fly   134 FSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAV--KFTAAEDLLSRAVLEVSCLTIMGTPTNF 196
            |.||::..|.|.|......:.|      ||..:||  :...|: .::..||::....::|.|...
  Fly   148 FHHNLLEKFIDTFVDASQSLYE------NLDAEAVGTEINIAK-YVNNCVLDILNEAVLGVPIKK 205

  Fly   197 TQLDDAHIAHS-YKRLLEISAVRVVKPWLQIRLLH---RLLAPELYEESKKCAKLLEDFVGGIVR 257
            ...|.|.:..| :::...:...|..:|||.:..::   ::...||.::     |.|.||...:::
  Fly   206 RGQDVAMMEDSPFRQGKIMMPARFTQPWLLLDGIYHWTKMANDELNQK-----KRLNDFTRKMIQ 265

  Fly   258 TKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLA-ANGEMTLEEIMDEAQSMVLVSFETVS 321
            .:.:       :....:|..     :|:..::.:.::: :|.:.|.|:|::||.:.:|...::|.
  Fly   266 RRRQ-------IQNNNNGNS-----ERKCLLDHMIEISESNRDFTEEDIVNEACTFMLAGQDSVG 318

  Fly   322 NSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQV-GLEQLQQLRYLDAFVSESLRLLATVPMNL 385
            .::...|..|..|. :||.|.:.|:..:..|..:. .:..|.::||::..:.|:|||..:||:..
  Fly   319 AAVAFTLFLLTQNP-ECQDRCVLELATIFEDSNRAPTMTDLHEMRYMEMCIKEALRLYPSVPLIA 382

  Fly   386 RHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDS 450
            |.:..:.|||  :|  .:|..|.|.:..:...|....: .:..:|.|:||..:..|         
  Fly   383 RKLGEEVRLA--KH--TLPAGSNVFICPYATHRLAHIY-PDPEKFQPERFSPENSE--------- 433

  Fly   451 GSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498
                      .||.|:|||||.|.|.|||.|:.:..:|..:.:|:.::
  Fly   434 ----------NRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSY 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 104/438 (24%)
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 104/438 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.