DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:300 Identity:67/300 - (22%)
Similarity:115/300 - (38%) Gaps:65/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 KRLLEISAVRVVKPWLQIRLLHRLLAPELYEE--SKKCAKLLEDFVGGIVRTKHRNWRLRDAVGG 271
            :::|:..:|..:..|..:      |.|:::.|  ::....|::|         |.          
  Fly   221 RKVLDFMSVFFLPKWTGV------LKPKVFTEDYARYMRHLVDD---------HH---------- 260

  Fly   272 EKSGEDASNGWQRRIFIEQIFQLAANGEMTLEE---IMDEAQSMVLVSFETVSNSIMLALLCLAT 333
            |.:..|..|..|.       |||:.:.....:.   :..:|..::|..||| |:::|...|....
  Fly   261 EPTKGDLINQLQH-------FQLSRSSNHYSQHPDFVASQAGIILLAGFET-SSALMGFTLYELA 317

  Fly   334 NKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRH----VSRDFRL 394
            ...|.|.||.:|:|........:..:.|..|.||.....|:|||........|.    .|..|.|
  Fly   318 KAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSL 382

  Fly   395 AGRQH-ETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQ 458
              :.| :.|||......:....:.||||:| .....|||:||..:....:               
  Fly   383 --QPHVDFIVPPGMPAYISILGLHRDERFW-PEPCVFDPERFGPERSRHI--------------- 429

  Fly   459 RDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498
                |..:::||..|...|||.|.|:..:|:.:|.::..:
  Fly   430 ----HPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 67/299 (22%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 67/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.