DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:497 Identity:121/497 - (24%)
Similarity:209/497 - (42%) Gaps:109/497 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RPLAVLVGTRVLLY--------IDDPAGMECVLNAPECLDK----TFLQDGFFVRRGLLHARGQK 122
            |.||...|...|.|        :.|......:||.|..:.|    .||..  |:|.|:|.|..:|
  Fly    76 RQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHP--FLRTGVLTATEKK 138

  Fly   123 WKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCL 187
            |..||..|...|..:|:..|.::|.:...:.|.|||      ||.....:.:|.:||..|...|.
  Fly   139 WHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQFQ------GQNEVVVSLKDRISRFTLNSICE 197

  Fly   188 TIMGTP------------TNFTQLDDA------------------HIAHSYKRLLEISAVRVVKP 222
            |.||..            .||..:|:.                  ...|.|.     :|::||..
  Fly   198 TAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTGHKYN-----AALKVVHE 257

  Fly   223 WLQIRLLHR--LLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRR 285
            :.:..:..|  ||..||  |:::..:..:|.:  .|..|.|...|...:..||.|          
  Fly   258 FSREIIAKRRVLLEEEL--ENRRATQTADDDI--CVIRKKRFAMLDTLICAEKDG---------- 308

  Fly   286 IFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRA-L 349
             .|:.|            .|.:|..:::...::|.|..::..|:.::....: |.....||:. :
  Fly   309 -LIDDI------------GISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAE-QELCYQEIQEHI 359

  Fly   350 VPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTF 414
            :.|:..:.|.||.:|.||..|:.|::||..::|:..|...::..|   ::..|:|:.|.:.:..|
  Fly   360 LDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETEL---ENGLILPKRSQINIHVF 421

  Fly   415 NMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIG 479
            ::.|:.::| .:..:|.|:|||.|                   ...:||.|:::|||.|.|:|||
  Fly   422 DIHRNPKYW-ESPEEFRPERFLPQ-------------------NCLKRHPYAYIPFSAGQRNCIG 466

  Fly   480 RRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKN 521
            ::|.:..||..:|.::.:|......:.:.:.|...|:|:|||
  Fly   467 QKYAMQEMKTLMVVILKHFKILPVIDPKSIVFQVGITLRFKN 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 115/477 (24%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 121/497 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1605
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.