DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:489 Identity:109/489 - (22%)
Similarity:202/489 - (41%) Gaps:94/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFF-------VRRGLLHARGQKWKLRRK 128
            ||.|||...   ||....|....: ||        :|.||       :..|||.::|.||...|:
Mouse   105 PLLVLVHPD---YIKPVLGASAAI-AP--------KDEFFYSFLKPWLGDGLLISKGNKWSRHRR 157

  Fly   129 QLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAE-------DLLSRAVLEVSC 186
            .|.|||..:|:..:..:||...|.|..:::... ..|....|...|       |.|.:.|     
Mouse   158 LLTPAFHFDILKPYMKIFNQCTNIMHAKWRRHL-AEGSVTSFDMFEHISLMTLDSLQKCV----- 216

  Fly   187 LTIMGTPTNFTQLDDA--HIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELY------EESKK 243
                     |:...|.  .::.....::|:||:.|.:   |.||.|.|  ..:|      ...::
Mouse   217 ---------FSYNSDCQERMSDYISSIIELSALVVRR---QYRLHHYL--DFMYYLTADGRRFRQ 267

  Fly   244 CAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAAN---GEMTLEEI 305
            ....:.:|...:::.:.:..|.:.|....|:.:..:..     ||: :..||.:   .|::.|:|
Mouse   268 ACDTVHNFTTEVIQERRQALRQQGAEAWLKAKQGKTLD-----FID-VLLLAKDEEGKELSDEDI 326

  Fly   306 MDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVP--DVGQVGLEQLQQLRYLD 368
            ..||.:.:....:|.|:.:..||..|| ...:.|.:...||:.::.  ::.::..:.|.||.:..
Mouse   327 RAEADTFMFEGHDTTSSGLSWALFNLA-KYPEYQEKCREEIQEVMKGRELEELDWDDLTQLPFTT 390

  Fly   369 AFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDP 432
            ..:.||||....|.:..|..:.|.:|. ||    ::|:..|.::..:....:...| .:::.::|
Mouse   391 MCIKESLRQFPPVTLISRRCTEDIKLPDGR----VIPKGIICLVSIYGTHHNPIVW-PDSKVYNP 450

  Fly   433 QRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITN 497
            .|| |.:..|                  :|...:|:|||.|.|:|||:.:.:..|:|.:...:..
Mouse   451 YRF-DPDTPQ------------------QRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLR 496

  Fly   498 FDFQSDFELEKLQFVENISLKFKNADDILLTIQP 531
            |....| ...|::....:.|:.:|.  :.|.::|
Mouse   497 FRLSVD-RTHKVRRKPELILRTENG--LWLNVEP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 103/459 (22%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 105/473 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.