DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:496 Identity:104/496 - (20%)
Similarity:201/496 - (40%) Gaps:113/496 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QQPVLWLLLCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLN--------- 95
            ||.:.|    :...|.:.|:.:|..:            ||||||  ||..::.||.         
  Rat    70 QQVLTW----VEKFPGACLQWLSGSK------------TRVLLY--DPDYVKVVLGRSDPKASGI 116

  Fly    96 ----APECLDKTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQ 156
                ||..:..|    |:    |||...|:||....:.|.|||.:.|:..:..:.....:.|:::
  Rat   117 YQFLAPWIVSGT----GY----GLLLLNGKKWFQHWRMLTPAFHYGILKPYVKIMADSVSIMLDK 173

  Fly   157 FQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTI----------MGTPTNFTQLDDAHIAHSYKRL 211
            ::...:           :|........||.:|:          .|:    .|||..  :.||.:.
  Rat   174 WEKLDD-----------QDHPLEIFHYVSLMTLDTVMKCAFSHQGS----VQLDVN--SRSYTKA 221

  Fly   212 LE----ISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGE 272
            :|    ::..||...:....:::.:.:..  ..|::..::..:...|::  |.|..:|::.    
  Rat   222 VEDLNNLTFFRVRSAFYGNSIIYNMSSDG--RLSRRACQIAHEHTDGVI--KMRKAQLQNE---- 278

  Fly   273 KSGEDASNGWQRR--IFIE-QIFQLAANGE-MTLEEIMDEAQSMVLVSFETVSNSIMLALLCLAT 333
               |:.....::|  .|:: .:|....:|: ::.|::..|..:.:....:|.::.|......|||
  Rat   279 ---EELQKARKKRHLDFLDILLFAKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALAT 340

  Fly   334 NKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GR 397
            :. :.|.|...|:::::.|...|..:.|.|:.|....:.|:|||...||...|.:|...... ||
  Rat   341 HP-EHQERCREEVQSILGDGTSVTWDHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGR 404

  Fly   398 QHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRR 462
            .    :|:.....:..:.:..:..:| .|.:.|||.||.....                     |
  Rat   405 S----IPKGITTTILIYGLHHNPSYW-PNPKVFDPSRFSPDSP---------------------R 443

  Fly   463 HSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSD 503
            ||:::||||.|.|:|||:::.:..:||.:...:..|:...|
  Rat   444 HSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPD 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 101/492 (21%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 104/496 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.