DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:443 Identity:111/443 - (25%)
Similarity:190/443 - (42%) Gaps:76/443 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LLYIDDPAGMECVLNAPECL---DKTFLQDGFFVR----RGLLHARGQKWKLRRKQLNPAFSHNI 138
            ::.|..||.::.|:.||..:   |:.|.:   |::    .|||.:.|.||...|..|.|||..||
  Rat    98 VIRIFHPAFIKPVILAPASVAPKDRVFYR---FLKPWLGDGLLLSTGDKWSRHRHMLTPAFHFNI 159

  Fly   139 VASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLT-------IMGTPTNF 196
            :..:..:||...|.|..::|   .|..|.   :|..|:..    .:|.:|       :....:|.
  Rat   160 LKPYVKIFNDSTNIMHAKWQ---RLASQG---SARLDMFE----HISLMTLDSLQKCVFSFDSNC 214

  Fly   197 TQLDDAHIAHSYKRLLEISAV---RVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRT 258
            .:....:|.    .:||:||:   |.....|.:.|.:.|....:  ..:|..:|:.||...::|.
  Rat   215 QEKPSEYIT----AILELSALVARRHQSLLLYVDLFYHLTRDGM--RFRKACRLVHDFTDAVIRE 273

  Fly   259 KHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLA----ANGE-MTLEEIMDEAQSMVLVSFE 318
            :.|.  |.|     :.|:||.....:...::.|..|.    .:|| ::.|:|..||.:.:....:
  Rat   274 RRRT--LPD-----QGGDDALKAKAKAKTLDFIDVLLLSKDEHGEALSDEDIRAEADTFMFGGHD 331

  Fly   319 TVSNSIMLALLCLATNKGDCQRRLLAEIRALVPD--VGQVGLEQLQQLRYLDAFVSESLRLLATV 381
            |.::.:...|..||.:. :.|.|...|:|.|:.|  ..::..:.|.||.:|...:.|||||....
  Rat   332 TTASGLSWILYNLAKHP-EYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPA 395

  Fly   382 PMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSK 445
            ....|..::|..|. ||    ::|:..|..:..|....:...| .:...::|.||          
  Rat   396 TAISRCCTQDIMLPDGR----VIPKGVICRISIFGTHHNPAVW-PDPEVYNPFRF---------- 445

  Fly   446 GHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498
               |:.:||      .|...:|:|||.|.|:|||:.:.:..|||.|...:..|
  Rat   446 ---DADNGE------GRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 111/443 (25%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 111/443 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.