DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP4A22

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:539 Identity:113/539 - (20%)
Similarity:192/539 - (35%) Gaps:132/539 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QLNGWRGVIQQPVLWLLLC-------INLHPNSILEKVSQYRV--------HFQR---------- 70
            :|.|..|::|...|.:||.       :.||...:|:.:.|:..        |.|.          
Human    11 RLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRI 75

  Fly    71 -------PLAV---LVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRR---GLLHARGQK 122
                   |.|.   :.|.:|.:.:.||..|:.:|...:  .|:.....|...|   |||...||.
Human    76 QERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSD--PKSHGSYKFLAPRIGYGLLLLNGQT 138

  Fly   123 WKLRRKQLNPAFSHNIVASF------------------------FDVFNSVGNQMVEQFQTQTNL 163
            |...|:.|.|||.::|:..:                        .:||..|....::........
Human   139 WFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFS 203

  Fly   164 HGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRL 228
            |..:::.........:|:.:::.|........|.:.|..:...|..|            |     
Human   204 HQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGR------------W----- 251

  Fly   229 LHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQ 293
            .||            ..:|.......:::.:....        :|.||......:|.:....|..
Human   252 THR------------ACQLAHQHTDQVIQLRKAQL--------QKEGELEKIKRKRHLDFLDILL 296

  Fly   294 LA--ANGE-MTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQ 355
            ||  .||. ::.:::..|..:.:....:|.::.|...|..|||:... |.|...||..|:.|...
Human   297 LAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKH-QERCREEIHGLLGDGAS 360

  Fly   356 VGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRD 419
            :....|.|:.|....:.|:|||...||...|.:|...... ||.    :|:..:|:|..:.:..:
Human   361 ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRS----LPKGIMVLLSIYGLHHN 421

  Fly   420 ERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGL 484
            .:.| .|...|||.||.             .||.:        ||::|||||.|.|:|||:::.:
Human   422 PKVW-PNLEVFDPSRFA-------------PGSAQ--------HSHAFLPFSGGSRNCIGKQFAM 464

  Fly   485 FIMKVFLVKLITNFDFQSD 503
            ..:||.....:..|:...|
Human   465 NQLKVARALTLLRFELLPD 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 108/526 (21%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 102/498 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.